Comparing 7022816 FitnessBrowser__ANA3:7022816 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P11551 L-fucose-proton symporter; 6-deoxy-L-galactose permease; L-fucose permease; L-fucose-H(+) symport protein from Escherichia coli (strain K12) (see 3 papers)
24% identity, 91% coverage: 4:371/406 of query aligns to 15:412/438 of P11551
Sites not aligning to the query:
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
25% identity, 40% coverage: 10:173/406 of query aligns to 24:185/448 of Q51955
Sites not aligning to the query:
Q8RWN2 Protein ZINC INDUCED FACILITATOR 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 30% coverage: 41:163/406 of query aligns to 63:189/486 of Q8RWN2
Sites not aligning to the query:
>7022816 FitnessBrowser__ANA3:7022816
MVSDSNSVENRHHTRIRVLTYLMFFMFAMTSDAVGVIIPQLISEFGLSLSQASAFHYMPM
IFIAISGLFLGFLADKIGRKLTILLGLLLFAIACFLFALGESFYYFLLLLALVGLAIGVF
KTGALALIGDISRSTKQHSSTMNTVEGFFGVGAMVGPAIVSYLLISGVSWKYLYFGAGVF
CLLLCWLAFRADYPQVKRSSTETINLTNTFSMMKNPYALGFSLAIGLYVATEVAIYVWMP
SLLQEYQGDYTVLAAYALTIFFTLRAGGRFLGGWILNHFSWQQVMFWFSLAISLCYLGSM
LYGVEAAVILLPLSGLFMSMMYPTLNSKGISCFPVAQHGSVAGVILFFTAVSAALAPLCM
GLVGDIFGHVKYGFYLATGFAVLLCLLAGVNLIKDPSQALLSRETA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory