Comparing 7022920 FitnessBrowser__ANA3:7022920 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2p3nA Thermotoga maritima impase tm1415 (see paper)
31% identity, 76% coverage: 29:234/270 of query aligns to 27:218/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
31% identity, 76% coverage: 29:234/270 of query aligns to 27:218/256 of O33832
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
29% identity, 92% coverage: 4:252/270 of query aligns to 4:253/274 of 2bjiA
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
29% identity, 92% coverage: 4:252/270 of query aligns to 6:255/277 of P20456
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 87% coverage: 1:234/270 of query aligns to 1:238/271 of Q9M8S8
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
28% identity, 91% coverage: 4:248/270 of query aligns to 4:249/274 of 4as5A
O55023 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Mus musculus (Mouse) (see paper)
29% identity, 91% coverage: 4:248/270 of query aligns to 6:251/277 of O55023
Q19420 Inositol monophosphatase ttx-7; IMP; IMPase; Abnormal thermotaxis protein 7; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase; EC 3.1.3.25; EC 3.1.3.94 from Caenorhabditis elegans (see paper)
27% identity, 90% coverage: 6:248/270 of query aligns to 13:261/285 of Q19420
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
28% identity, 93% coverage: 4:255/270 of query aligns to 2:254/266 of 1imdA
6zk0AAA human impase with ebselen (see paper)
28% identity, 93% coverage: 4:255/270 of query aligns to 3:255/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
28% identity, 93% coverage: 4:255/270 of query aligns to 4:256/274 of 4as4A
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
28% identity, 93% coverage: 4:255/270 of query aligns to 6:258/277 of P29218
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
28% identity, 93% coverage: 4:255/270 of query aligns to 2:254/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
28% identity, 93% coverage: 4:255/270 of query aligns to 2:254/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
28% identity, 93% coverage: 4:255/270 of query aligns to 2:254/272 of 1awbA
6giuA Human impase with l-690330 (see paper)
28% identity, 93% coverage: 4:255/270 of query aligns to 4:256/275 of 6giuA
5djkA Structure of m. Tuberculosis cysq, a pap phosphatase with po4 and 2ca bound (see paper)
32% identity, 75% coverage: 43:244/270 of query aligns to 37:223/251 of 5djkA
5djjA Structure of m. Tuberculosis cysq, a pap phosphatase with po4 and 2mg bound (see paper)
32% identity, 75% coverage: 43:244/270 of query aligns to 43:229/257 of 5djjA
O14732 Inositol monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol monophosphatase A2; EC 3.1.3.25 from Homo sapiens (Human) (see 2 papers)
29% identity, 88% coverage: 4:240/270 of query aligns to 17:254/288 of O14732
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
30% identity, 82% coverage: 11:232/270 of query aligns to 7:225/255 of 5yhtA
>7022920 FitnessBrowser__ANA3:7022920
MKPEELIDEVIAIATDAGRTIREIYLKGNFERETKSDNTPVTSADLAANQLICERLAALT
PDIPILSEEAADIPLSVREGWKRYWLVDPLDGTGEFIAGSGDFSVIIALVEHNRPVMGVV
YVPMTQVCYYAIAGLGAYKRTDKQEVRISSRQIQHREQVSLRLAVSRRQDPQSVLTLFNQ
PKHCELVVMGGAALKSCLVAEGRADCYVRVGPTGEWDTGAAQIIIEEAGGQLMDTELQPL
TYNERETLENPNFIVVGAPNLEWDKILIGE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory