SitesBLAST
Comparing 7023011 FitnessBrowser__ANA3:7023011 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yq3AAA Monooxygenase (see paper)
38% identity, 99% coverage: 3:253/253 of query aligns to 4:251/252 of 6yq3AAA
- active site: G16 (= G15), S146 (≠ T145), Y159 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (= R14), G16 (= G15), I17 (≠ L16), H35 (≠ T34), A37 (≠ Q36), S38 (= S37), N39 (= N38), L64 (≠ V63), N96 (= N95), A97 (= A96), A98 (≠ G97), V119 (≠ I118), I144 (≠ V143), Y159 (= Y158), K163 (= K162), P189 (= P188), G190 (= G189), I191 (≠ A190), T192 (≠ I191), N194 (≠ T193)
- binding (3~{R})-8-methoxy-3-methyl-3,6-bis(oxidanyl)-2,4-dihydrobenzo[a]anthracene-1,7,12-trione: S146 (≠ T145), G147 (= G146), L148 (= L147), Q156 (≠ F155), Y159 (= Y158), I191 (≠ A190), T249 (≠ M251)
6ypzAAA Monooxygenase (see paper)
39% identity, 99% coverage: 3:253/253 of query aligns to 4:253/253 of 6ypzAAA
- active site: G16 (= G15), S148 (≠ T145), Y161 (= Y158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (= R14), G16 (= G15), I17 (≠ L16), H35 (≠ T34), A37 (≠ Q36), S38 (= S37), N39 (= N38), L64 (≠ V63), N96 (= N95), A97 (= A96), A98 (≠ G97), T100 (vs. gap), I146 (≠ V143), S147 (= S144), S148 (≠ T145), Y161 (= Y158), K165 (= K162), P191 (= P188), G192 (= G189), I193 (≠ A190), T194 (≠ I191), N196 (≠ T193)
6yq0AAA Monooxygenase (see paper)
39% identity, 99% coverage: 3:253/253 of query aligns to 4:253/254 of 6yq0AAA
- active site: G16 (= G15), S148 (≠ T145), Y161 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (= R14), G16 (= G15), I17 (≠ L16), H35 (≠ T34), A37 (≠ Q36), S38 (= S37), N39 (= N38), L64 (≠ V63), N96 (= N95), A97 (= A96), A98 (≠ G97), T100 (vs. gap), R117 (≠ T114), I146 (≠ V143), S147 (= S144), S148 (≠ T145), Y161 (= Y158), K165 (= K162), P191 (= P188), G192 (= G189), I193 (≠ A190), T194 (≠ I191), N196 (≠ T193)
- binding (3~{R})-8-methoxy-3-methyl-3-oxidanyl-2,4-dihydrobenzo[a]anthracene-1,7,12-trione: T100 (vs. gap), G101 (= G99), S148 (≠ T145), G149 (= G146), L150 (= L147), C153 (≠ F150), Q158 (≠ F155), Y161 (= Y158), G192 (= G189), I193 (≠ A190), T251 (≠ M251)
3iccA Crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution (see paper)
36% identity, 100% coverage: 1:253/253 of query aligns to 4:255/255 of 3iccA
- active site: G18 (= G15), S148 (≠ T145), F158 (= F155), Y161 (= Y158), K165 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G11), S16 (= S13), R17 (= R14), G18 (= G15), I19 (≠ L16), H37 (≠ T34), Y38 (= Y35), G39 (≠ Q36), L66 (≠ V63), E67 (≠ G64), N98 (= N95), G100 (= G97), I146 (≠ V143), S148 (≠ T145), Y161 (= Y158), K165 (= K162), P191 (= P188), G192 (= G189), M198 (≠ F195), N199 (≠ G196)
7nm8AAA Antimycin pathway standalone ketoreductase, AntM (see paper)
36% identity, 98% coverage: 7:253/253 of query aligns to 9:250/251 of 7nm8AAA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), S15 (= S13), R16 (= R14), G17 (= G15), I18 (≠ L16), H36 (≠ T34), Y37 (= Y35), G38 (≠ Q36), H39 (≠ S37), L65 (≠ V63), N97 (= N95), G99 (= G97), S147 (≠ T145), Y160 (= Y158), K164 (= K162), G191 (= G189), T193 (≠ I191), T195 (= T193)
4ospA The crystal structure of urdamycin c-6 ketoreductase domain urdmred with bound NADP and rabelomycin (see paper)
37% identity, 99% coverage: 3:253/253 of query aligns to 4:251/252 of 4ospA
- active site: G16 (= G15), S146 (≠ T145), Y159 (= Y158), K163 (= K162)
- binding rabelomycin: M100 (≠ G99), S146 (≠ T145), G147 (= G146), L148 (= L147), F151 (= F150), I191 (≠ A190)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), R15 (= R14), G16 (= G15), I17 (≠ L16), H35 (≠ T34), C36 (≠ Y35), S37 (≠ Q36), E63 (≠ D62), L64 (≠ V63), N96 (= N95), V99 (≠ I98), R115 (≠ T114), I144 (≠ V143), S146 (≠ T145), Y159 (= Y158), K163 (= K162), P189 (= P188), T192 (≠ I191), N194 (≠ T193)
4kwhB The crystal structure of angucyclinE C-6 ketoreductase lanv with bound NADP (see paper)
36% identity, 99% coverage: 3:253/253 of query aligns to 9:256/257 of 4kwhB
- active site: G21 (= G15), S151 (≠ T145), Y164 (= Y158), K168 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G17 (= G11), S19 (= S13), R20 (= R14), G21 (= G15), I22 (≠ L16), H40 (≠ T34), A42 (≠ Q36), T43 (≠ S37), G44 (≠ N38), E68 (≠ D62), L69 (≠ V63), N101 (= N95), M105 (≠ G99), Y164 (= Y158), K168 (= K162), P194 (= P188), S196 (≠ A190), T197 (≠ I191), N199 (≠ T193)
4osoA The crystal structure of landomycin c-6 ketoreductase lanv with bound NADP and rabelomycin (see paper)
36% identity, 99% coverage: 3:253/253 of query aligns to 4:251/252 of 4osoA
- active site: G16 (= G15), S146 (≠ T145), Y159 (= Y158), K163 (= K162)
- binding rabelomycin: M100 (≠ G99), S146 (≠ T145), G147 (= G146), L148 (= L147), Y159 (= Y158), G190 (= G189), L211 (≠ Q213), T249 (≠ M251)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (= R14), I17 (≠ L16), H35 (≠ T34), Y36 (= Y35), A37 (≠ Q36), T38 (≠ S37), G39 (≠ N38), L64 (≠ V63), N96 (= N95), A97 (= A96), G98 (= G97), M100 (≠ G99), V144 (= V143), Y159 (= Y158), K163 (= K162), P189 (= P188), G190 (= G189), T192 (≠ I191), N194 (≠ T193)
4kwiA The crystal structure of angucyclinE C-6 ketoreductase lanv with bound NADP and 11-deoxy-6-oxylandomycinone (see paper)
36% identity, 99% coverage: 3:253/253 of query aligns to 4:251/252 of 4kwiA
- active site: G16 (= G15), S146 (≠ T145), Y159 (= Y158), K163 (= K162)
- binding 1,8-dihydroxy-3-methyltetraphene-6,7,12(5H)-trione: M100 (≠ G99), G147 (= G146), L148 (= L147), V151 (≠ F150), Q156 (≠ F155), G190 (= G189), L198 (≠ V200), L208 (= L210), L211 (≠ Q213)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (= R14), G16 (= G15), I17 (≠ L16), H35 (≠ T34), A37 (≠ Q36), T38 (≠ S37), L64 (≠ V63), N96 (= N95), Y159 (= Y158), K163 (= K162), P189 (= P188), T192 (≠ I191), N194 (≠ T193)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
35% identity, 97% coverage: 6:251/253 of query aligns to 13:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G11), S20 (= S13), K21 (≠ R14), G22 (= G15), I23 (≠ L16), A43 (≠ Q36), S44 (= S37), S45 (≠ N38), G68 (= G64), D69 (= D65), V70 (≠ S66), N96 (= N95), S97 (≠ A96), G98 (= G97), Y100 (≠ G99), I144 (≠ V143), S146 (≠ T145), Y159 (= Y158), K163 (= K162), P189 (= P188), G190 (= G189), M191 (≠ A190), I192 (= I191), T194 (= T193), G196 (≠ F195), T197 (≠ G196)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (≠ T145), Y159 (= Y158), M191 (≠ A190), I202 (≠ R201)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
33% identity, 98% coverage: 5:253/253 of query aligns to 6:247/247 of 4jroC
- active site: G16 (= G15), S142 (≠ T145), Q152 (≠ F155), Y155 (= Y158), K159 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (= R14), G16 (= G15), I17 (≠ L16), N35 (≠ T34), Y36 (= Y35), N37 (≠ Q36), G38 (≠ S37), S39 (≠ N38), N63 (≠ D62), V64 (= V63), N90 (= N95), A91 (= A96), I93 (= I98), I113 (= I118), S142 (≠ T145), Y155 (= Y158), K159 (= K162), P185 (= P188), I188 (= I191), T190 (= T193)
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
35% identity, 97% coverage: 6:250/253 of query aligns to 7:244/247 of 6j7uA
- active site: G16 (= G15), S142 (≠ T145), Y156 (= Y158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (= R14), I17 (≠ L16), Y36 (= Y35), V37 (≠ Q36), S38 (= S37), S41 (≠ A40), D65 (= D62), S66 (≠ V63), N92 (= N95), A93 (= A96), G94 (= G97), I115 (= I118), G141 (≠ S144), S142 (≠ T145), Y156 (= Y158), K160 (= K162), P186 (= P188), T191 (= T193), M193 (≠ F195), N194 (≠ G196)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
36% identity, 99% coverage: 3:253/253 of query aligns to 5:246/247 of P73574
- A14 (= A12) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P153) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K162) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ A190) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (= N207) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
5thqB Comprehensive analysis of a novel ketoreductase for pentangular polyphenol biosynthesis (see paper)
32% identity, 97% coverage: 7:251/253 of query aligns to 10:249/250 of 5thqB
- active site: G18 (= G15), L25 (= L22), V32 (= V29), S142 (≠ T145), R152 (≠ F155), Y155 (= Y158), K159 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G11), S16 (= S13), R17 (= R14), G18 (= G15), V19 (≠ L16), R39 (≠ Q36), A64 (≠ L61), L66 (≠ V63), N92 (= N95), A93 (= A96), V95 (≠ I98), I140 (≠ V143), S142 (≠ T145), Y155 (= Y158), K159 (= K162), G186 (= G189), V187 (≠ A190), V188 (≠ I191)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
34% identity, 100% coverage: 1:253/253 of query aligns to 1:246/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
33% identity, 98% coverage: 7:253/253 of query aligns to 4:239/239 of 3sj7A
- active site: G12 (= G15), S138 (≠ T145), Q148 (≠ F155), Y151 (= Y158), K155 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), S10 (= S13), R11 (= R14), I13 (≠ L16), N31 (≠ T34), Y32 (= Y35), A33 (≠ Q36), G34 (≠ S37), S35 (≠ N38), A58 (≠ L61), N59 (≠ D62), V60 (= V63), N86 (= N95), A87 (= A96), T109 (≠ I118), S138 (≠ T145), Y151 (= Y158), K155 (= K162), P181 (= P188), G182 (= G189)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
32% identity, 98% coverage: 4:251/253 of query aligns to 1:242/244 of 1edoA
- active site: G12 (= G15), S138 (≠ T145), Y151 (= Y158), K155 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), S10 (= S13), R11 (= R14), I13 (≠ L16), N31 (≠ T34), Y32 (= Y35), A33 (≠ Q36), R34 (≠ S37), S35 (≠ N38), D59 (= D65), V60 (≠ S66), N86 (= N95), A87 (= A96), S138 (≠ T145), Y151 (= Y158), K155 (= K162), P181 (= P188), G182 (= G189), I184 (= I191), S186 (≠ T193), M188 (≠ F195)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
33% identity, 97% coverage: 6:250/253 of query aligns to 8:248/252 of 1vl8B
- active site: G17 (= G15), S143 (= S144), I154 (≠ F155), Y157 (= Y158), K161 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), R16 (= R14), G17 (= G15), L18 (= L16), S37 (≠ Y35), R38 (≠ Q36), C63 (≠ L61), D64 (= D62), V65 (= V63), A91 (≠ N95), A92 (= A96), G93 (= G97), I94 (= I98), V114 (≠ I118), I141 (≠ V143), S143 (= S144), Y157 (= Y158), K161 (= K162), P187 (= P188), G188 (= G189), Y190 (≠ I191), T192 (= T193), M194 (≠ F195), T195 (≠ G197)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 98% coverage: 6:253/253 of query aligns to 9:244/244 of 4nbuB
- active site: G18 (= G15), N111 (≠ H119), S139 (≠ T145), Q149 (≠ F155), Y152 (= Y158), K156 (= K162)
- binding acetoacetyl-coenzyme a: D93 (≠ H101), K98 (≠ E106), S139 (≠ T145), N146 (≠ V152), V147 (≠ P153), Q149 (≠ F155), Y152 (= Y158), F184 (≠ A190), M189 (≠ A199), K200 (≠ F209)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G11), N17 (≠ R14), G18 (= G15), I19 (≠ L16), D38 (≠ Q36), F39 (≠ S37), V59 (≠ L61), D60 (= D62), V61 (= V63), N87 (= N95), A88 (= A96), G89 (= G97), I90 (= I98), T137 (≠ V143), S139 (≠ T145), Y152 (= Y158), K156 (= K162), P182 (= P188), F184 (≠ A190), T185 (≠ I191), T187 (= T193), M189 (≠ A199)
3oidB Crystal structure of enoyl-acp reductases iii (fabl) from b. Subtilis (complex with NADP and tcl) (see paper)
32% identity, 100% coverage: 1:253/253 of query aligns to 1:248/251 of 3oidB
- active site: G15 (= G15), S141 (≠ T145), Y151 (≠ F155), V154 (≠ Y158), K158 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), S13 (= S13), R14 (= R14), G15 (= G15), V16 (≠ L16), A36 (≠ Q36), R37 (≠ S37), S38 (≠ N38), A61 (≠ L61), N62 (≠ D62), V63 (= V63), N89 (= N95), A90 (= A96), A91 (≠ G97), I112 (= I118), I139 (≠ V143), S140 (= S144), S141 (≠ T145), K158 (= K162), G185 (= G189), A186 (= A190), I187 (= I191), T189 (= T193), A191 (= A199)
- binding triclosan: S92 (≠ I98), G93 (= G99), Y151 (≠ F155), A191 (= A199), H194 (≠ D202), F195 (≠ N203)
Query Sequence
>7023011 FitnessBrowser__ANA3:7023011
MNTAPIALITGASRGLGKNAALTLAAQGVDIILTYQSNAAAAAEVVAEIEWHGRKAVALP
LDVGDSQSFSDFSLRVKAALEQTWLRDSFNYLVNNAGIGIHVPMAETSVEQFDTLMNIHV
KGPFFLTQALLPLLADNGSIINVSTGLTRFAVPGFGAYAIMKGAVETMTKYWAKELGPRG
IRVNVLAPGAIETDFGGGAVRDNPKMNEFLAQQTALGRVGLPEDIGGAISVLLSPAAAWI
NAQRIEASGGMFL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory