SitesBLAST
Comparing 7023023 FitnessBrowser__ANA3:7023023 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q46856 Alcohol dehydrogenase YqhD; EC 1.1.1.2 from Escherichia coli (strain K12) (see paper)
57% identity, 100% coverage: 1:384/385 of query aligns to 1:386/387 of Q46856
- GGS 38:40 (≠ GSS 38:40) binding
- 93:99 (vs. 93:99, 86% identical) binding
- T138 (= T136) binding
- N147 (= N145) binding
- K160 (= K158) binding
- YTYT 179:182 (≠ KTFT 177:180) binding
- D194 (= D192) binding
- H198 (= H196) binding
- H267 (= H265) binding
- H281 (= H279) binding
1oj7B Structural genomics, unknown function crystal structure of e. Coli k-12 yqhd (see paper)
57% identity, 99% coverage: 3:384/385 of query aligns to 6:389/390 of 1oj7B
- binding 5,6-dihydroxy-nadp: G41 (= G38), S43 (= S40), P70 (= P67), N71 (= N68), G97 (= G94), G98 (= G95), S99 (= S96), D102 (= D99), T141 (= T136), L142 (= L137), T145 (= T140), S147 (= S142), G152 (≠ A147), V154 (= V149), K163 (= K158), T185 (= T180), L186 (= L181), P187 (= P182), Q190 (= Q185), H201 (= H196), H270 (= H265), H284 (= H279)
- binding zinc ion: D197 (= D192), H201 (= H196), H270 (= H265), H284 (= H279)
1oj7A Structural genomics, unknown function crystal structure of e. Coli k-12 yqhd (see paper)
57% identity, 99% coverage: 3:384/385 of query aligns to 6:389/390 of 1oj7A
- binding 5,6-dihydroxy-nadp: G41 (= G38), S43 (= S40), P70 (= P67), N71 (= N68), G97 (= G94), G98 (= G95), S99 (= S96), D102 (= D99), T141 (= T136), L142 (= L137), T145 (= T140), S147 (= S142), N150 (= N145), G152 (≠ A147), K163 (= K158), T185 (= T180), L186 (= L181), Q190 (= Q185), D197 (= D192), H201 (= H196), H270 (= H265), H284 (= H279)
7w9yA Crystal structure of bacillus subtilis yugj in complex with NADP and nickel (see paper)
39% identity, 99% coverage: 1:383/385 of query aligns to 3:384/389 of 7w9yA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G40 (= G37), G41 (= G38), S43 (= S40), P72 (= P67), N73 (= N68), G99 (= G94), G100 (= G95), S101 (= S96), T140 (= T136), L141 (= L137), T144 (= T140), K162 (= K158), T184 (= T180), V185 (≠ L181), P186 (= P182), H189 (≠ Q185), H283 (= H279)
7w9zA Crystal structure of bacillus subtilis yugj in complex with NADP and nitrate (see paper)
41% identity, 92% coverage: 3:357/385 of query aligns to 2:360/381 of 7w9zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G37 (= G37), G38 (= G38), S40 (= S40), P69 (= P67), G96 (= G94), G97 (= G95), S98 (= S96), D101 (= D99), T137 (= T136), L138 (= L137), T141 (= T140), N146 (= N145), G148 (≠ A147), K159 (= K158), T181 (= T180), V182 (≠ L181), P183 (= P182), H186 (≠ Q185)
- binding nitrate ion: R72 (≠ T70), V73 (≠ Y71), S74 (≠ E72), V150 (= V149), N153 (≠ R152), W154 (≠ K153), E155 (≠ S154), W263 (= W262), H270 (= H269), H280 (= H279)
8i29A Crystal structure of butanol dehydrogenase a (yqdh) in complex with nadh from fusobacterium nucleatum
35% identity, 90% coverage: 3:349/385 of query aligns to 2:349/384 of 8i29A
- binding cobalt (ii) ion: E205 (= E199), H271 (= H265), H285 (= H279)
- binding nicotinamide-adenine-dinucleotide: A102 (≠ G95), T142 (= T136), I143 (≠ L137), A146 (≠ T140), S148 (= S142), S151 (≠ N145), S153 (≠ A147), I155 (≠ V149), T186 (= T180), I187 (≠ L181), L191 (≠ Q185)
7fjgA Crystal structure of butanol dehydrogenase a (yqdh) in complex with partial nadh from fusobacterium nucleatum
35% identity, 90% coverage: 3:349/385 of query aligns to 2:349/384 of 7fjgA
1vljB Crystal structure of nadh-dependent butanol dehydrogenase a (tm0820) from thermotoga maritima at 1.78 a resolution
36% identity, 93% coverage: 1:358/385 of query aligns to 6:365/400 of 1vljB
- binding fe (iii) ion: D200 (= D192), H204 (= H196), H273 (= H265), H287 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G45 (= G38), S47 (= S40), P76 (= P67), G103 (= G94), G104 (= G95), S105 (= S96), D108 (= D99), T144 (= T136), I145 (≠ L137), T148 (= T140), T150 (≠ S142), N153 (= N145), N155 (≠ A147), K166 (= K158), T188 (= T180), L189 (= L181), Q193 (= Q185), H204 (= H196), H287 (= H279)
1vhdA Crystal structure of an iron containing alcohol dehydrogenase (see paper)
27% identity, 81% coverage: 4:316/385 of query aligns to 3:304/361 of 1vhdA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (= S39), S40 (= S40), E69 (≠ P67), N70 (= N68), G96 (= G94), G97 (= G95), S98 (= S96), D101 (= D99), T137 (= T136), T138 (≠ L137), T141 (= T140), S143 (= S142), T146 (≠ N145), Y148 (≠ A147), I150 (≠ V149), K158 (≠ A157), S178 (≠ T180), M179 (≠ L181), L183 (≠ Q185), D190 (= D192), H194 (= H196), H271 (= H279)
- binding zinc ion: D190 (= D192), H194 (= H196), H257 (= H265), H271 (= H279)
1o2dA Crystal structure of alcohol dehydrogenase, iron-containing (tm0920) from thermotoga maritima at 1.30 a resolution (see paper)
27% identity, 81% coverage: 4:316/385 of query aligns to 2:303/359 of 1o2dA
- binding fe (iii) ion: D189 (= D192), H193 (= H196), H256 (= H265), H270 (= H279)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S38 (= S39), S39 (= S40), E68 (≠ P67), N69 (= N68), G95 (= G94), G96 (= G95), S97 (= S96), D100 (= D99), T136 (= T136), T137 (≠ L137), T140 (= T140), S142 (= S142), Y147 (≠ A147), I149 (≠ V149), K157 (≠ A157), S177 (≠ T180), M178 (≠ L181), L182 (≠ Q185), D189 (= D192), H193 (= H196), H270 (= H279)
6jkpA Crystal structure of sulfoacetaldehyde reductase from bifidobacterium kashiwanohense in complex with NAD+ (see paper)
24% identity, 78% coverage: 6:306/385 of query aligns to 6:303/376 of 6jkpA
- binding nicotinamide-adenine-dinucleotide: F42 (vs. gap), G96 (= G95), D100 (= D99), T137 (= T136), T138 (≠ L137), T141 (= T140), S143 (= S142), T146 (≠ N145), S181 (≠ T180), V182 (≠ L181), P183 (= P182)
6jkoA Crystal structure of sulfoacetaldehyde reductase from bifidobacterium kashiwanohense (see paper)
24% identity, 78% coverage: 6:306/385 of query aligns to 6:303/376 of 6jkoA
3zdrA Structure of the alcohol dehydrogenase (adh) domain of a bifunctional adhe dehydrogenase from geobacillus thermoglucosidasius ncimb 11955 (see paper)
24% identity, 91% coverage: 9:360/385 of query aligns to 8:372/403 of 3zdrA
Q59104 4-hydroxybutyrate dehydrogenase; 4HbD; Gamma-hydroxybutyrate dehydrogenase; GHBDH; EC 1.1.1.61 from Cupriavidus necator (Alcaligenes eutrophus) (Ralstonia eutropha) (see paper)
27% identity, 82% coverage: 4:317/385 of query aligns to 3:321/382 of Q59104
- D193 (= D192) mutation to A: Retains very low activity.
- H197 (= H196) mutation to A: Loss of activity.
- H261 (= H260) mutation to A: Loss of activity.
- H265 (≠ T264) mutation to A: 75% decrease in Vmax. Optimum pH is 9.5.; mutation to C: 95% decrease in Vmax. Optimum pH is 8.5.; mutation to D: Retains very low activity.; mutation to Y: Loss of activity.
- H280 (= H279) mutation to A: Retains very low activity.
3bfjA Crystal structure analysis of 1,3-propanediol oxidoreductase (see paper)
28% identity, 91% coverage: 4:352/385 of query aligns to 3:348/382 of 3bfjA
A0A0S1X9S7 Alcohol dehydrogenase; EC 1.1.1.1 from Thermococcus barophilus (see paper)
29% identity, 75% coverage: 10:299/385 of query aligns to 8:298/378 of A0A0S1X9S7
- D195 (= D192) mutation to A: Disrupts the overall structure of the enzyme. Lack of acetaldehyde reduction activity and displays weak ethanol oxidation activity.
- H199 (= H196) mutation to A: Disrupts the overall structure of the enzyme. Retains 10% of ethanol oxidation and acetaldehyde reduction activities.
- H262 (= H265) mutation to A: Disrupts the overall structure of the enzyme. Displays weak ethanol oxidation and acetaldehyde reduction activities.
- H266 (= H269) mutation to A: Disrupts the overall structure of the enzyme. Displays higher acetaldehyde reduction activity (134%) but lower ethanol oxidation activity (36%).
- H274 (= H279) mutation to A: Disrupts the overall structure of the enzyme. Retains 20% of ethanol oxidation and acetaldehyde reduction activities.
P31005 NAD-dependent methanol dehydrogenase; MDH; MEDH; Type 3 alcohol dehydrogenase; EC 1.1.1.244 from Bacillus methanolicus (see 3 papers)
24% identity, 80% coverage: 1:307/385 of query aligns to 1:303/381 of P31005
- M1 (= M1) modified: Initiator methionine, Removed
- G13 (= G15) mutation to A: Shows a reduced dehydrogenase activity.
- G15 (≠ N17) mutation to A: Shows almost the same dehydrogenase activity as the wild-type.
- D88 (= D87) mutation to N: Shows almost the same dehydrogenase activity as the wild-type.
- G95 (= G94) mutation to A: Shows a 10-fold decreased affinity for NAD and NADH and a strongly reduced dehydrogenase activity. Completely insensitive to the stimulating effect of the activator protein Act.
- S97 (= S96) mutation to G: Shows an increase of the dehydrogenase activity and a decrease of the affinity for NAD and NADH. Completely insensitive to the stimulating effect of the activator protein Act. It does not bind NAD.; mutation to T: Shows an increase of the dehydrogenase activity and affinity for NAD and NADH.
- D100 (= D99) mutation to N: Loss of dehydrogenase activity. It still binds NADH.
- K103 (= K102) mutation to R: Loss of dehydrogenase activity. It does not bind NADH.
P0DJA2 Alcohol dehydrogenase 2; Alcohol dehydrogenase II; ADH II; EC 1.1.1.1 from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) (see 2 papers)
27% identity, 75% coverage: 62:351/385 of query aligns to 65:350/383 of P0DJA2
- N71 (= N68) binding
- G98 (= G95) binding
- S99 (= S96) binding
- T138 (= T136) binding
- T139 (≠ L137) binding
- T147 (≠ N145) binding
- F149 (≠ A147) binding
- K160 (= K158) binding
- L179 (≠ K177) binding
- G182 (≠ T180) binding
- M183 (≠ L181) binding
- D194 (= D192) binding
- H198 (= H196) binding
- H263 (= H265) binding
- H267 (= H269) binding
- H277 (= H279) binding ; binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 39 binding
3ox4A Structures of iron-dependent alcohol dehydrogenase 2 from zymomonas mobilis zm4 complexed with NAD cofactor (see paper)
27% identity, 75% coverage: 62:351/385 of query aligns to 64:349/382 of 3ox4A
- binding fe (ii) ion: D193 (= D192), H197 (= H196), H262 (= H265), H276 (= H279)
- binding nicotinamide-adenine-dinucleotide: N70 (= N68), G96 (= G94), G97 (= G95), S98 (= S96), T137 (= T136), T138 (≠ L137), F148 (≠ A147), I150 (≠ V149), G181 (≠ T180), M182 (≠ L181), L186 (≠ Q185), H276 (= H279)
Sites not aligning to the query:
3owoA Structures of iron-dependent alcohol dehydrogenase 2 from zymomonas mobilis zm4 with and without NAD cofactor (see paper)
27% identity, 75% coverage: 62:351/385 of query aligns to 64:349/382 of 3owoA
Query Sequence
>7023023 FitnessBrowser__ANA3:7023023
MFNFAYYNPTRIHFGKNTIAEIDTLVPRNARVMVLFGGSSARRTGTLAEVKQALGNRFVV
EFEGIEPNPTYETLMQAVEQVRELNIDFLLAVGGGSVIDGTKFVAAAAVFEGEPWDILTS
WGANVTQAMPFGSVLTLPATGSEMNNASVVTRKSLKAKLPFRNDLVYPQFSILDPTKTFT
LPERQVANGVVDAFVHITEQYLTYPVNAAVQDRFAEGLLQILIELGPQALTQPEDYDIRA
NLMWVATMALNGTIATGVPHDWATHMIGHELTALYDIDHARTLAIVLPALLRCTKAAKRE
KLLQFADRVWHINTGSEDERIEAAIAKTQAFFESMGIATHLSAYDLGKEAVDAVVNQLEQ
HGMVALGEHGNIDPTMSRDILTLAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory