SitesBLAST
Comparing 7023067 FitnessBrowser__ANA3:7023067 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ie0B X-ray crystal structure of 2r,3r-butanediol dehydrogenase from bacillus subtilis
32% identity, 95% coverage: 8:348/358 of query aligns to 1:346/347 of 6ie0B
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
27% identity, 91% coverage: 2:326/358 of query aligns to 2:321/343 of 4ej6A
- active site: C40 (= C44), G41 (= G45), T42 (≠ S46), H45 (= H49), H61 (= H81), E62 (= E82), C91 (vs. gap), C94 (vs. gap), C97 (vs. gap), C105 (≠ S112), R109 (≠ A116), P147 (= P156), C151 (≠ G160)
- binding zinc ion: C91 (vs. gap), C94 (vs. gap), C97 (vs. gap), C105 (≠ S112)
Sites not aligning to the query:
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
27% identity, 91% coverage: 2:326/358 of query aligns to 2:321/342 of 4ejmA
- active site: C40 (= C44), G41 (= G45), T42 (≠ S46), H45 (= H49), H61 (= H81), E62 (= E82), C91 (vs. gap), C94 (vs. gap), C97 (vs. gap), C105 (≠ S112), R109 (≠ A116), P147 (= P156), C151 (≠ G160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G179), G172 (= G181), V173 (≠ P182), I174 (= I183), T194 (≠ D203), R195 (≠ L204), Q196 (= Q205), K199 (= K208), C240 (= C246), E245 (≠ K251), T246 (≠ L252), L263 (≠ T269), V265 (≠ I271), I291 (≠ Y296)
- binding zinc ion: C91 (vs. gap), C94 (vs. gap), C97 (vs. gap), C105 (≠ S112)
Sites not aligning to the query:
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
25% identity, 93% coverage: 6:337/358 of query aligns to 1:334/351 of 3qe3A
- active site: C39 (= C44), G40 (= G45), S41 (= S46), H44 (= H49), H64 (= H81), E65 (= E82), R94 (≠ S112), D97 (≠ G115), C100 (≠ V118), S108 (vs. gap), F112 (vs. gap), P151 (= P156), G155 (= G160)
- binding glycerol: Y45 (≠ I50), F54 (= F60), T116 (= T121), R293 (≠ Y295)
- binding zinc ion: C39 (= C44), H64 (= H81), E65 (= E82)
Sites not aligning to the query:
1pl6A Human sdh/nadh/inhibitor complex (see paper)
25% identity, 92% coverage: 7:337/358 of query aligns to 7:339/356 of 1pl6A
- active site: C44 (= C44), G45 (= G45), S46 (= S46), H49 (= H49), H69 (= H81), E70 (= E82), R99 (≠ S112), D102 (≠ G115), C105 (≠ V118), S113 (vs. gap), F117 (vs. gap), P156 (= P156), G160 (= G160)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C44), S46 (= S46), I56 (≠ V57), F59 (= F60), H69 (= H81), E155 (= E155), L274 (≠ I271), F297 (≠ Y294)
- binding nicotinamide-adenine-dinucleotide: G181 (= G181), P182 (= P182), I183 (= I183), D203 (= D203), L204 (= L204), R208 (≠ K208), C249 (= C246), T250 (≠ V247), V272 (≠ T269), G273 (= G270), L274 (≠ I271), F297 (≠ Y294), R298 (≠ Y295)
- binding zinc ion: C44 (= C44), H69 (= H81)
Sites not aligning to the query:
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
25% identity, 93% coverage: 6:337/358 of query aligns to 5:337/354 of P07846
- C43 (= C44) binding
- Y49 (≠ I50) binding
- H67 (= H81) binding
- E68 (= E82) binding
- E153 (= E155) binding
- R296 (≠ Y295) binding
- Y297 (= Y296) binding
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
25% identity, 92% coverage: 7:337/358 of query aligns to 8:340/357 of Q00796
- C45 (= C44) binding
- H70 (= H81) binding
- E71 (= E82) binding
- R110 (vs. gap) to P: in SORDD; results in protein aggregation
- H135 (≠ L134) to R: in SORDD; results in protein aggregation
- A153 (= A152) to D: in SORDD; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (= I183) binding
- D204 (= D203) binding
- R209 (≠ K208) binding
- Q239 (≠ A236) to L: in dbSNP:rs1042079
- N269 (≠ T265) to T: in dbSNP:rs930337
- VGL 273:275 (≠ TGI 269:271) binding
- VFR 297:299 (≠ SYY 293:295) binding
- V322 (≠ L319) to I: in SORDD; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
29% identity, 77% coverage: 6:280/358 of query aligns to 2:277/350 of Q5JI69
Sites not aligning to the query:
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
29% identity, 73% coverage: 21:280/358 of query aligns to 17:275/347 of 3gfbA
- active site: C40 (= C44), G41 (= G45), T42 (≠ S46), H45 (= H49), H65 (= H81), E66 (= E82), C95 (≠ S106), C98 (≠ I109), C101 (vs. gap), C109 (≠ S112), K113 (≠ A116), P151 (= P156), A155 (≠ G160)
- binding nicotinamide-adenine-dinucleotide: G173 (= G179), G175 (= G181), P176 (= P182), L177 (≠ I183), S196 (≠ A202), E197 (≠ D203), P198 (≠ L204), R202 (≠ K208), F241 (≠ C246), S242 (≠ V247), A244 (≠ I249), L264 (≠ T269), G265 (= G270), L266 (≠ I271)
Sites not aligning to the query:
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
25% identity, 93% coverage: 5:337/358 of query aligns to 6:340/357 of P27867
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
27% identity, 73% coverage: 21:280/358 of query aligns to 19:277/348 of O58389
- C42 (= C44) binding
- T44 (≠ S46) mutation to A: Total loss of enzymatic activity.
- H67 (= H81) binding
- E68 (= E82) binding
- C97 (≠ S106) binding
- C100 (≠ I109) binding
- C103 (vs. gap) binding
- C111 (≠ S112) binding
- E152 (= E155) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I183) binding
- E199 (≠ D203) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (≠ K208) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ TGI 269:271) binding
Sites not aligning to the query:
- 291:292 binding
- 294 R→A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
27% identity, 73% coverage: 21:280/358 of query aligns to 17:275/346 of 2dfvA
- active site: C40 (= C44), G41 (= G45), T42 (≠ S46), H45 (= H49), H65 (= H81), E66 (= E82), C95 (≠ S106), C98 (≠ I109), C101 (vs. gap), C109 (≠ S112), K113 (≠ A116), P151 (= P156), A155 (≠ G160)
- binding nicotinamide-adenine-dinucleotide: G175 (= G181), P176 (= P182), L177 (≠ I183), E197 (≠ D203), P198 (≠ L204), R202 (≠ K208), F241 (≠ C246), S242 (≠ V247), A244 (≠ I249), L264 (≠ T269), G265 (= G270), L266 (≠ I271)
- binding zinc ion: C95 (≠ S106), C101 (vs. gap), C109 (≠ S112)
Sites not aligning to the query:
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
25% identity, 95% coverage: 7:346/358 of query aligns to 1:344/348 of 1e3jA
- active site: C38 (= C44), G39 (= G45), S40 (= S46), H43 (= H49), H63 (= H81), E64 (= E82), C93 (≠ I109), C96 (≠ S112), C99 (vs. gap), C107 (vs. gap), T111 (≠ G117), P150 (= P156), G154 (= G160), K341 (= K343)
- binding phosphate ion: A174 (≠ C180), A196 (≠ D203), R197 (≠ L204), S198 (≠ Q205), R201 (≠ K208)
- binding zinc ion: C38 (= C44), H63 (= H81), E64 (= E82), C93 (≠ I109), C96 (≠ S112), C99 (vs. gap), C107 (vs. gap)
5kiaA Crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis
25% identity, 92% coverage: 9:337/358 of query aligns to 2:328/339 of 5kiaA
- active site: C37 (= C44), G38 (= G45), T39 (≠ S46), H42 (= H49), H61 (= H81), E62 (= E82), C91 (vs. gap), C94 (vs. gap), C97 (vs. gap), C105 (≠ S112), V109 (≠ A116), P147 (= P156), A151 (≠ G160)
- binding calcium ion: D146 (≠ E155), N150 (≠ V159), E288 (≠ Q297)
- binding zinc ion: C91 (vs. gap), C94 (vs. gap), C97 (vs. gap), C105 (≠ S112)
Sites not aligning to the query:
4ilkA Crystal structure of short chain alcohol dehydrogenase (rspb) from e. Coli cft073 (efi target efi-506413) complexed with cofactor nadh
27% identity, 91% coverage: 9:332/358 of query aligns to 4:320/337 of 4ilkA
- active site: C40 (= C44), G41 (= G45), S42 (= S46), H45 (= H49), H59 (= H81), E60 (= E82), C89 (vs. gap), C92 (vs. gap), C95 (≠ M111), C103 (≠ G119), A107 (≠ G123), P145 (= P156), A149 (≠ G160)
- binding manganese (ii) ion: C40 (= C44), H59 (= H81), E60 (= E82), E144 (= E155)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G168 (= G179), G170 (= G181), P171 (= P182), I172 (= I183), D193 (= D203), R194 (≠ L204), R198 (≠ K208), N213 (≠ P223), A235 (≠ E245), A236 (≠ C246), C237 (≠ V247), I241 (≠ K251), M258 (≠ T269), F260 (≠ I271)
- binding zinc ion: C89 (vs. gap), C92 (vs. gap), C95 (≠ M111), C103 (≠ G119)
Sites not aligning to the query:
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
25% identity, 91% coverage: 9:335/358 of query aligns to 1:328/341 of P07913
- C38 (= C44) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
29% identity, 79% coverage: 18:301/358 of query aligns to 13:301/357 of 7y9pA
Q96V44 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Hypocrea jecorina (Trichoderma reesei) (see paper)
26% identity, 88% coverage: 32:347/358 of query aligns to 54:374/377 of Q96V44
- DI 224:225 (≠ DL 203:204) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-362.
- A362 (≠ M336) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 224-SR-225.
3m6iA L-arabinitol 4-dehydrogenase (see paper)
26% identity, 88% coverage: 32:347/358 of query aligns to 37:356/358 of 3m6iA
- active site: C49 (= C44), G50 (= G45), S51 (= S46), H54 (= H49), H74 (= H81), E75 (= E82), C104 (≠ S112), C107 (≠ V120), C110 (≠ G123), C118 (≠ Y131), D122 (= D135), P160 (= P156), A164 (≠ G160), K352 (= K343)
- binding nicotinamide-adenine-dinucleotide: C49 (= C44), V163 (= V159), G185 (= G181), P186 (= P182), I187 (= I183), D207 (= D203), R212 (≠ K208), C255 (= C246), T256 (≠ V247), I278 (≠ T269), G279 (= G270), V280 (≠ I271), R304 (≠ Y295)
- binding zinc ion: C49 (= C44), H74 (= H81), C104 (≠ S112), C107 (≠ V120), C110 (≠ G123), C118 (≠ Y131)
Q7SI09 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) (see 2 papers)
26% identity, 88% coverage: 32:347/358 of query aligns to 41:360/363 of Q7SI09
- C53 (= C44) binding
- F59 (= F60) mutation F->A,S,Y: No effect.
- H78 (= H81) binding
- E79 (= E82) binding
- C108 (≠ S112) binding
- C111 (≠ V120) binding
- C114 (≠ G123) binding
- C122 (≠ Y131) binding
- E163 (= E155) binding
- PI 190:191 (= PI 182:183) binding
- D211 (= D203) binding
- DI 211:212 (≠ DL 203:204) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-348.
- R216 (≠ K208) binding
- I282 (≠ T269) binding
- QYR 306:308 (≠ SYY 293:295) binding
- S348 (≠ M336) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 211-SR-212.
Query Sequence
>7023067 FitnessBrowser__ANA3:7023067
MSMMNAQTMKAIVMQDGEVTLQQVDLPKPQVGQVLVRSLACGICGSDIHITRHYSEVFSF
YRKLGVMPEGVDDHVPVMLGHEFCAEVVEFGPQTQQTLAVGTRVTSVPILMSQNGAGVGV
TPGVNGAYSEYFILDEALLMPVPEHLPPEAVALTEPLAVGLHAVNRGDVGVEDTALVVGC
GPIGLAAISALHLRGVRNIIAADLQGEKLQLAREFGATHTVNPGEQDEVAYAAEVAEGHR
VVIFECVGIHKLIEGFVKRAPAKATIVVTGIHTAEANINYAYATVKELDMRFSYYYQPDE
FAACLAELAQGTIPWRKLLTGKVGMDGVSGAFKQLMKPNPHIKVVIEPWRNGELETLN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory