Comparing 7023084 FitnessBrowser__ANA3:7023084 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
45% identity, 88% coverage: 14:202/215 of query aligns to 16:202/210 of 6pubA
Sites not aligning to the query:
6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
45% identity, 88% coverage: 14:202/215 of query aligns to 13:199/206 of 6u9cA
6pxaE The crystal structure of chloramphenicol acetyltransferase-like protein from vibrio fischeri es114 in complex with taurocholic acid
41% identity, 92% coverage: 8:204/215 of query aligns to 10:213/221 of 6pxaE
5ux9A The crystal structure of chloramphenicol acetyltransferase from vibrio fischeri es114
41% identity, 92% coverage: 8:204/215 of query aligns to 5:208/215 of 5ux9A
2xatA Complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a (see paper)
38% identity, 91% coverage: 10:204/215 of query aligns to 8:201/208 of 2xatA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
37% identity, 93% coverage: 10:210/215 of query aligns to 16:211/211 of 4hurA
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
37% identity, 93% coverage: 10:210/215 of query aligns to 16:211/212 of 4husA
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
38% identity, 91% coverage: 10:204/215 of query aligns to 16:205/206 of 6x3jA
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
38% identity, 91% coverage: 10:204/215 of query aligns to 16:205/207 of 6x3cA
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
37% identity, 90% coverage: 10:202/215 of query aligns to 16:203/203 of 6x3cE
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
40% identity, 73% coverage: 27:183/215 of query aligns to 33:185/203 of 3dhoA
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
40% identity, 73% coverage: 27:183/215 of query aligns to 33:185/204 of 1mrlA
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
40% identity, 73% coverage: 27:183/215 of query aligns to 33:185/206 of 1khrA
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
40% identity, 73% coverage: 27:183/215 of query aligns to 33:185/209 of P50870
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
40% identity, 73% coverage: 27:183/215 of query aligns to 33:185/205 of 1kk4A
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
43% identity, 28% coverage: 103:163/215 of query aligns to 122:182/190 of 5u2kA
Sites not aligning to the query:
7uujA Crystal structure of aminoglycoside resistance enzyme apma, complex with gentamicin
38% identity, 32% coverage: 114:182/215 of query aligns to 179:249/272 of 7uujA
Sites not aligning to the query:
7jm2A Crystal structure of aminoglycoside resistance enzyme apma, complex with apramycin
38% identity, 32% coverage: 114:182/215 of query aligns to 179:249/272 of 7jm2A
Sites not aligning to the query:
7jm1A Crystal structure of aminoglycoside resistance enzyme apma, complex with acetyl-coa
38% identity, 32% coverage: 114:182/215 of query aligns to 179:249/272 of 7jm1A
Sites not aligning to the query:
7uukC Crystal structure of aminoglycoside resistance enzyme apma, complex with tobramycin (see paper)
38% identity, 32% coverage: 114:182/215 of query aligns to 181:251/276 of 7uukC
Sites not aligning to the query:
>7023084 FitnessBrowser__ANA3:7023084
MLMENKHWSKVQLLHQVVTNPNITIKGEHSYYSDCWDKGFEESVVRYLYGDEISLTWDPL
WEIDKLHIGDYVCIGAEAVILMGGNHTHRADWFCLYPFMDVIEEAYVGKGDTHIGDGAWL
GMRAMIMPGVSIGEGAIVAANSVVTQDVAPYSIVGGTPAKLVKYRFEPSVIDELLGLRIY
DWPQAKFESLRRYLCASDIEKLKEAALAYDAQHCA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory