SitesBLAST
Comparing 7023118 Shewana3_0356 acetolactate synthase 2 catalytic subunit (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
45% identity, 99% coverage: 3:552/557 of query aligns to 90:660/667 of P09342
- C161 (= C73) modified: Disulfide link with 307
- P194 (≠ S106) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V213) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
45% identity, 99% coverage: 3:552/557 of query aligns to 87:657/664 of P09114
- P191 (≠ S106) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W470) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
46% identity, 99% coverage: 3:552/557 of query aligns to 8:578/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M256), R292 (= R282), W489 (= W470), S568 (≠ P542)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V381), G401 (= G382), Q402 (= Q383), H403 (= H384), G426 (= G407), M428 (= M409), G452 (= G433), D453 (= D434), G454 (= G435), S455 (= S436), L483 (= L464), G484 (= G465), M485 (= M466), V486 (= V467)
- binding flavin-adenine dinucleotide: R161 (= R155), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (≠ K238), M263 (= M253), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), R288 (= R278), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), M405 (= M386), G423 (≠ A404)
- binding magnesium ion: A37 (= A32), T82 (= T76), S83 (= S77), Q122 (= Q116), Y381 (= Y359), D453 (= D434), M458 (= M439), Q461 (= Q442), N480 (= N461), H482 (≠ K463), K533 (≠ S507)
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
46% identity, 99% coverage: 3:552/557 of query aligns to 8:578/583 of 5k3sA
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), S38 (≠ I33), E59 (= E53), T82 (= T76), F121 (= F115), Q122 (= Q116), E123 (= E117), K171 (= K165), M266 (= M256), V293 (= V283), V400 (= V381), G426 (= G407), M428 (= M409), D453 (= D434), N480 (= N461), H482 (≠ K463), L483 (= L464), M485 (= M466), V486 (= V467), W489 (= W470), H558 (≠ D532)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R282), M485 (= M466), W489 (= W470), G569 (= G543)
- binding flavin-adenine dinucleotide: R161 (= R155), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (≠ K238), L264 (= L254), M266 (= M256), G286 (= G276), R288 (= R278), D290 (= D280), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), M405 (= M386), G423 (≠ A404)
- binding magnesium ion: D453 (= D434), N480 (= N461), H482 (≠ K463)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V381), G401 (= G382), Q402 (= Q383), H403 (= H384), G426 (= G407), M428 (= M409), D453 (= D434), G454 (= G435), S455 (= S436), N480 (= N461), H482 (≠ K463), L483 (= L464), G484 (= G465), M485 (= M466), V486 (= V467)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
46% identity, 99% coverage: 3:552/557 of query aligns to 8:578/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V381), G401 (= G382), Q402 (= Q383), H403 (= H384), G426 (= G407), M428 (= M409), G452 (= G433), D453 (= D434), G454 (= G435), S455 (= S436), M458 (= M439), N480 (= N461), H482 (≠ K463), L483 (= L464), G484 (= G465), M485 (= M466), V486 (= V467)
- binding flavin-adenine dinucleotide: R161 (= R155), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (≠ K238), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), M405 (= M386), G423 (≠ A404)
- binding magnesium ion: F370 (≠ Y351), D453 (= D434), M458 (= M439), Q461 (= Q442), N480 (= N461), H482 (≠ K463), K533 (≠ S507)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M256), R292 (= R282), M485 (= M466), W489 (= W470), S568 (≠ P542)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
46% identity, 99% coverage: 3:552/557 of query aligns to 8:578/582 of 5wj1A
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), S38 (≠ I33), E59 (= E53), T82 (= T76), F121 (= F115), Q122 (= Q116), E123 (= E117), K171 (= K165), M266 (= M256), V293 (= V283), V400 (= V381), G426 (= G407), M428 (= M409), D453 (= D434), N480 (= N461), H482 (≠ K463), L483 (= L464), M485 (= M466), V486 (= V467), W489 (= W470), H558 (≠ D532)
- binding flavin-adenine dinucleotide: R161 (= R155), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (≠ K238), M263 (= M253), L264 (= L254), G286 (= G276), R288 (= R278), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), M405 (= M386), G423 (≠ A404), G424 (= G405)
- binding magnesium ion: D453 (= D434), N480 (= N461), H482 (≠ K463)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M256), D291 (= D281), R292 (= R282), M485 (= M466), W489 (= W470), S568 (≠ P542)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V381), G401 (= G382), Q402 (= Q383), H403 (= H384), M428 (= M409), D453 (= D434), G454 (= G435), S455 (= S436), M458 (= M439), N480 (= N461), H482 (≠ K463), L483 (= L464), G484 (= G465), M485 (= M466), V486 (= V467)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
46% identity, 99% coverage: 3:552/557 of query aligns to 8:578/582 of 5k6tA
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), S38 (≠ I33), E59 (= E53), T82 (= T76), F121 (= F115), Q122 (= Q116), E123 (= E117), K171 (= K165), M266 (= M256), V293 (= V283), V400 (= V381), G426 (= G407), M428 (= M409), D453 (= D434), N480 (= N461), H482 (≠ K463), L483 (= L464), M485 (= M466), V486 (= V467), W489 (= W470), H558 (≠ D532)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H257), R292 (= R282), M485 (= M466), W489 (= W470), S568 (≠ P542)
- binding flavin-adenine dinucleotide: R161 (= R155), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (≠ K238), L264 (= L254), G286 (= G276), R288 (= R278), D290 (= D280), R292 (= R282), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), Q404 (= Q385), M405 (= M386), G423 (≠ A404)
- binding magnesium ion: D453 (= D434), N480 (= N461), H482 (≠ K463)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V381), G401 (= G382), Q402 (= Q383), H403 (= H384), G426 (= G407), M428 (= M409), G452 (= G433), G454 (= G435), S455 (= S436), N480 (= N461), H482 (≠ K463), L483 (= L464), G484 (= G465)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
46% identity, 99% coverage: 3:552/557 of query aligns to 8:578/582 of 5k6rA
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), S38 (≠ I33), E59 (= E53), T82 (= T76), F121 (= F115), Q122 (= Q116), E123 (= E117), K171 (= K165), M266 (= M256), V293 (= V283), V400 (= V381), G426 (= G407), M428 (= M409), D453 (= D434), N480 (= N461), H482 (≠ K463), L483 (= L464), M485 (= M466), V486 (= V467), W489 (= W470), H558 (≠ D532)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R282), W489 (= W470), S568 (≠ P542)
- binding flavin-adenine dinucleotide: R161 (= R155), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (≠ K238), L264 (= L254), M266 (= M256), G286 (= G276), R288 (= R278), R292 (= R282), V293 (= V283), D310 (= D300), I311 (= I301), G328 (= G318), D329 (= D319), V330 (≠ L320), M405 (= M386), G423 (≠ A404)
- binding magnesium ion: D453 (= D434), N480 (= N461), H482 (≠ K463)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V381), G401 (= G382), Q402 (= Q383), H403 (= H384), G426 (= G407), M428 (= M409), D453 (= D434), G454 (= G435), S455 (= S436), M458 (= M439), N480 (= N461), H482 (≠ K463), L483 (= L464), G484 (= G465), M485 (= M466), V486 (= V467)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
46% identity, 99% coverage: 3:552/557 of query aligns to 8:578/582 of 1z8nA
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), S38 (≠ I33), E59 (= E53), T82 (= T76), F121 (= F115), Q122 (= Q116), E123 (= E117), K171 (= K165), M266 (= M256), V293 (= V283), V400 (= V381), G426 (= G407), M428 (= M409), D453 (= D434), N480 (= N461), H482 (≠ K463), L483 (= L464), M485 (= M466), V486 (= V467), W489 (= W470), H558 (≠ D532)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K129), R161 (= R155), Y191 (≠ L179), R194 (≠ T182), D291 (= D281), R292 (= R282), D312 (= D302), W489 (= W470), G569 (= G543)
- binding flavin-adenine dinucleotide: R161 (= R155), G222 (= G210), G224 (= G212), T246 (= T236), L247 (= L237), M248 (≠ K238), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), M405 (= M386), G423 (≠ A404), G424 (= G405)
- binding magnesium ion: D453 (= D434), N480 (= N461)
- binding thiamine diphosphate: V400 (= V381), G401 (= G382), Q402 (= Q383), H403 (= H384), G426 (= G407), M428 (= M409), G452 (= G433), G454 (= G435), S455 (= S436), N480 (= N461), H482 (≠ K463), L483 (= L464), G484 (= G465), M485 (= M466), V486 (= V467)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
46% identity, 99% coverage: 3:552/557 of query aligns to 8:578/582 of 1yi1A
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), S38 (≠ I33), E59 (= E53), T82 (= T76), F121 (= F115), Q122 (= Q116), E123 (= E117), K171 (= K165), M266 (= M256), V293 (= V283), V400 (= V381), G426 (= G407), M428 (= M409), D453 (= D434), N480 (= N461), H482 (≠ K463), L483 (= L464), M485 (= M466), V486 (= V467), W489 (= W470), H558 (≠ D532)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D281), R292 (= R282), W489 (= W470), S568 (≠ P542)
- binding flavin-adenine dinucleotide: R161 (= R155), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (≠ K238), M263 (= M253), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), M405 (= M386), G423 (≠ A404), G424 (= G405)
- binding magnesium ion: D453 (= D434), N480 (= N461), H482 (≠ K463)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
46% identity, 99% coverage: 3:552/557 of query aligns to 8:578/582 of 1yi0A
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), S38 (≠ I33), E59 (= E53), T82 (= T76), F121 (= F115), Q122 (= Q116), E123 (= E117), K171 (= K165), M266 (= M256), V293 (= V283), V400 (= V381), G426 (= G407), M428 (= M409), D453 (= D434), N480 (= N461), H482 (≠ K463), L483 (= L464), M485 (= M466), V486 (= V467), W489 (= W470), H558 (≠ D532)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D281), R292 (= R282), W489 (= W470), S568 (≠ P542)
- binding flavin-adenine dinucleotide: R161 (= R155), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (≠ K238), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (= V283), D310 (= D300), I311 (= I301), G328 (= G318), D329 (= D319), V330 (≠ L320), M405 (= M386), G423 (≠ A404), G424 (= G405)
- binding magnesium ion: D453 (= D434), N480 (= N461), H482 (≠ K463)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
46% identity, 99% coverage: 3:552/557 of query aligns to 8:578/582 of 1yhzA
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), S38 (≠ I33), E59 (= E53), T82 (= T76), F121 (= F115), Q122 (= Q116), E123 (= E117), K171 (= K165), M266 (= M256), V293 (= V283), V400 (= V381), G426 (= G407), M428 (= M409), D453 (= D434), N480 (= N461), H482 (≠ K463), L483 (= L464), M485 (= M466), V486 (= V467), W489 (= W470), H558 (≠ D532)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D281), R292 (= R282), M485 (= M466), W489 (= W470), S568 (≠ P542)
- binding flavin-adenine dinucleotide: R161 (= R155), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (≠ K238), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), Q404 (= Q385), M405 (= M386), G423 (≠ A404), G424 (= G405)
- binding magnesium ion: D453 (= D434), N480 (= N461), H482 (≠ K463)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
46% identity, 99% coverage: 3:552/557 of query aligns to 8:578/582 of 1yhyA
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), S38 (≠ I33), E59 (= E53), T82 (= T76), F121 (= F115), Q122 (= Q116), E123 (= E117), K171 (= K165), M266 (= M256), V293 (= V283), V400 (= V381), G426 (= G407), M428 (= M409), D453 (= D434), N480 (= N461), H482 (≠ K463), L483 (= L464), M485 (= M466), V486 (= V467), W489 (= W470), H558 (≠ D532)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D281), R292 (= R282), V486 (= V467), W489 (= W470), S568 (≠ P542)
- binding flavin-adenine dinucleotide: R161 (= R155), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (≠ K238), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), Q404 (= Q385), M405 (= M386), G423 (≠ A404), G424 (= G405)
- binding magnesium ion: D453 (= D434), N480 (= N461), H482 (≠ K463)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
46% identity, 99% coverage: 3:552/557 of query aligns to 8:578/582 of 1ybhA
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), S38 (≠ I33), E59 (= E53), T82 (= T76), F121 (= F115), Q122 (= Q116), E123 (= E117), K171 (= K165), M266 (= M256), V293 (= V283), V400 (= V381), G426 (= G407), M428 (= M409), D453 (= D434), N480 (= N461), H482 (≠ K463), L483 (= L464), M485 (= M466), V486 (= V467), W489 (= W470), H558 (≠ D532)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M256), D291 (= D281), R292 (= R282), M485 (= M466), W489 (= W470), S568 (≠ P542)
- binding flavin-adenine dinucleotide: R161 (= R155), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (≠ K238), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), Q404 (= Q385), M405 (= M386), G423 (≠ A404), G424 (= G405)
- binding magnesium ion: D453 (= D434), N480 (= N461), H482 (≠ K463)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
46% identity, 99% coverage: 3:552/557 of query aligns to 93:663/670 of P17597
- A122 (= A32) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (= M34) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E53) binding
- S186 (= S95) binding
- P197 (≠ S106) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ A108) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q116) binding
- K220 (= K129) binding
- R246 (= R155) binding ; binding
- K256 (= K165) binding
- G308 (= G211) binding
- TL 331:332 (= TL 236:237) binding
- C340 (≠ H245) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 254:257) binding
- GVRFD 371:375 (≠ GARFD 276:280) binding
- DR 376:377 (= DR 281:282) binding
- DI 395:396 (= DI 300:301) binding
- DV 414:415 (≠ DL 319:320) binding
- QH 487:488 (= QH 383:384) binding
- GG 508:509 (≠ AG 404:405) binding
- GAM 511:513 (≠ GTM 407:409) binding
- D538 (= D434) binding
- DGS 538:540 (= DGS 434:436) binding
- N565 (= N461) binding
- NQHLGM 565:570 (≠ NQKLGM 461:466) binding
- H567 (≠ K463) binding
- W574 (= W470) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ P542) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
46% identity, 99% coverage: 3:552/557 of query aligns to 8:578/585 of 5k2oA
- active site: Y33 (= Y28), G35 (= G30), G36 (= G31), A37 (= A32), S38 (≠ I33), E59 (= E53), T82 (= T76), F121 (= F115), Q122 (= Q116), E123 (= E117), K171 (= K165), M266 (= M256), V293 (= V283), V400 (= V381), G426 (= G407), M428 (= M409), D453 (= D434), N480 (= N461), H482 (≠ K463), L483 (= L464), M485 (= M466), V486 (= V467), W489 (= W470), H558 (≠ D532)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M256), R292 (= R282), W489 (= W470), S568 (≠ P542)
- binding flavin-adenine dinucleotide: R161 (= R155), G222 (= G210), G223 (= G211), G224 (= G212), T246 (= T236), L247 (= L237), M248 (≠ K238), L264 (= L254), G286 (= G276), R288 (= R278), D290 (= D280), V293 (= V283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ L320), Q404 (= Q385), M405 (= M386), G423 (≠ A404)
- binding magnesium ion: D453 (= D434), N480 (= N461), H482 (≠ K463)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V381), G401 (= G382), Q402 (= Q383), H403 (= H384), M428 (= M409), D453 (= D434), G454 (= G435), S455 (= S436), N480 (= N461), H482 (≠ K463), L483 (= L464), G484 (= G465), M485 (= M466), V486 (= V467)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
46% identity, 99% coverage: 3:552/557 of query aligns to 7:577/582 of 3ea4A
- active site: Y32 (= Y28), G34 (= G30), G35 (= G31), A36 (= A32), S37 (≠ I33), E58 (= E53), T81 (= T76), F120 (= F115), Q121 (= Q116), E122 (= E117), K170 (= K165), M265 (= M256), V292 (= V283), V399 (= V381), G425 (= G407), M427 (= M409), D452 (= D434), N479 (= N461), H481 (≠ K463), L482 (= L464), M484 (= M466), V485 (= V467), W488 (= W470), H557 (≠ D532)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D281), R291 (= R282), W488 (= W470), S567 (≠ P542)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R155), G221 (= G210), G222 (= G211), G223 (= G212), T245 (= T236), L246 (= L237), M247 (≠ K238), L263 (= L254), G264 (= G255), M265 (= M256), H266 (= H257), G285 (= G276), R287 (= R278), D289 (= D280), R291 (= R282), D309 (= D300), I310 (= I301), G327 (= G318), D328 (= D319), V329 (≠ L320), M404 (= M386), G422 (≠ A404)
- binding magnesium ion: D452 (= D434), N479 (= N461), H481 (≠ K463)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V381), G400 (= G382), Q401 (= Q383), H402 (= H384), M427 (= M409), G451 (= G433), D452 (= D434), G453 (= G435), S454 (= S436), N479 (= N461), H481 (≠ K463), L482 (= L464), G483 (= G465), M484 (= M466), V485 (= V467)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
46% identity, 99% coverage: 3:552/557 of query aligns to 7:577/582 of 3e9yA
- active site: Y32 (= Y28), G34 (= G30), G35 (= G31), A36 (= A32), S37 (≠ I33), E58 (= E53), T81 (= T76), F120 (= F115), Q121 (= Q116), E122 (= E117), K170 (= K165), M265 (= M256), V292 (= V283), V399 (= V381), G425 (= G407), M427 (= M409), D452 (= D434), N479 (= N461), H481 (≠ K463), L482 (= L464), M484 (= M466), V485 (= V467), W488 (= W470), H557 (≠ D532)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D281), R291 (= R282), W488 (= W470), S567 (≠ P542)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R155), G221 (= G210), G222 (= G211), G223 (= G212), T245 (= T236), L246 (= L237), M247 (≠ K238), L263 (= L254), G285 (= G276), R287 (= R278), D289 (= D280), R291 (= R282), D309 (= D300), I310 (= I301), G327 (= G318), D328 (= D319), V329 (≠ L320), M404 (= M386), G422 (≠ A404)
- binding magnesium ion: D452 (= D434), N479 (= N461), H481 (≠ K463)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V381), G400 (= G382), Q401 (= Q383), H402 (= H384), M427 (= M409), G451 (= G433), G453 (= G435), S454 (= S436), N479 (= N461), H481 (≠ K463), L482 (= L464), G483 (= G465), M484 (= M466), V485 (= V467)
6lpiB Crystal structure of ahas holo-enzyme (see paper)
45% identity, 97% coverage: 9:550/557 of query aligns to 8:539/539 of 6lpiB
- active site: I27 (≠ Y28), G29 (= G30), G30 (= G31), S31 (≠ A32), I32 (= I33), E53 (= E53), C76 (≠ T76), F115 (= F115), Q116 (= Q116), E117 (= E117), K165 (= K165), M256 (= M256), A283 (≠ V283), V375 (= V381), G401 (= G407), M403 (= M409), D428 (= D434), N455 (= N461), A457 (≠ K463), L458 (= L464), L460 (≠ M466), V461 (= V467), Q464 (≠ W470)
- binding flavin-adenine dinucleotide: R155 (= R155), G212 (= G210), G213 (= G211), G214 (= G212), T236 (= T236), L237 (= L237), M238 (≠ K238), L254 (= L254), M256 (= M256), H257 (= H257), G276 (= G276), A277 (= A277), R278 (= R278), D280 (= D280), R282 (= R282), A283 (≠ V283), D300 (= D300), I301 (= I301), D319 (= D319), V320 (≠ L320), M380 (= M386), G398 (≠ A404)
- binding magnesium ion: D428 (= D434), N455 (= N461)
- binding thiamine diphosphate: E53 (= E53), C76 (≠ T76), P79 (= P79), G376 (= G382), Q377 (= Q383), H378 (= H384), G401 (= G407), M403 (= M409), G427 (= G433), D428 (= D434), G429 (= G435), S430 (= S436), M433 (= M439), N455 (= N461), A457 (≠ K463), L458 (= L464), G459 (= G465), L460 (≠ M466), V461 (= V467)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
43% identity, 99% coverage: 7:556/557 of query aligns to 8:583/596 of 1t9cA
- active site: Y29 (= Y28), G31 (= G30), G32 (= G31), A33 (= A32), I34 (= I33), E55 (= E53), T78 (= T76), F117 (= F115), Q118 (= Q116), E119 (= E117), K167 (= K165), R227 (≠ D220), M263 (= M256), V290 (= V283), V406 (= V381), L431 (= L406), G432 (= G407), M434 (= M409), D459 (= D434), N486 (= N461), E488 (≠ K463), Q489 (≠ L464), M491 (= M466), V492 (= V467), W495 (= W470), L517 (= L493), G522 (≠ D498), L523 (≠ I499), K556 (≠ D532)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G31), V107 (= V105), P108 (≠ S106), F117 (= F115), K167 (= K165), D288 (= D281), R289 (= R282), W495 (= W470)
- binding flavin-adenine dinucleotide: R157 (= R155), G216 (= G210), A217 (≠ G211), G218 (= G212), N221 (≠ G214), T243 (= T236), L244 (= L237), Q245 (≠ K238), L261 (= L254), M263 (= M256), H264 (= H257), G283 (= G276), A284 (= A277), R285 (= R278), D287 (= D280), R289 (= R282), V290 (= V283), E316 (≠ D300), V317 (≠ I301), N321 (≠ E305), G334 (= G318), D335 (= D319), A336 (vs. gap), M411 (= M386), G429 (≠ A404), G430 (= G405)
- binding magnesium ion: D459 (= D434), N486 (= N461), E488 (≠ K463)
Query Sequence
>7023118 Shewana3_0356 acetolactate synthase 2 catalytic subunit (RefSeq)
MEPGQMIRGADAVIKVLAAHGVTTVFGYPGGAIMPIYDALYGSPVEHLLSRHEQGAAFAA
VGYARASGKTGVCFATSGPGATNLITSLADALLDSVPVVAITGQVSTAVIGTDAFQEIDV
LGMSLSCTKHSFMVTDVNDLIPTLYQAFEIAASGRPGPVLVDIPKDIQIAQLEYRTPLLA
VTNEPQASASEIDAARALLAEAKQPMLYVGGGVGMAGAVDQLREFIKATGMPSVATLKGL
GSIAHGTPGYLGMLGMHGGKAANLAVQDCDLLVVAGARFDDRVTGRLATFANKAKVIHLD
IDAAELGKLRQPDVAIAGDLRQIFPALAMALNITPWQAEVEHLARKHQWDYQHPGSLIYA
PAMLRRLANKLPEDSVVCCDVGQHQMWVAQHMWFRRPEDHLSSAGLGTMGFGLPAAIGAQ
VARPDATVVTVSGDGSFMMNVQELTTIKRRKLPVKILLIDNQKLGMVKQWQQLFFEERYS
ETDLSDNPDFVQLASAFDIPGRTIFSSDEVEEALTEMLAAKGPYLLHVAIDDAFNVWPLV
PPGASNSDMMDEMEKQT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory