SitesBLAST
Comparing 7023121 FitnessBrowser__ANA3:7023121 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
58% identity, 95% coverage: 17:536/547 of query aligns to 2:512/514 of P04968
- K62 (= K81) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N108) binding
- GGGGL 188:192 (= GGGGL 207:211) binding
- S315 (= S338) binding
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
58% identity, 92% coverage: 35:536/547 of query aligns to 12:492/494 of 1tdjA
- active site: K58 (= K81), A83 (= A106), E209 (= E232), S213 (≠ A236), C215 (= C238), G237 (= G260), L310 (= L337), S311 (= S338)
- binding pyridoxal-5'-phosphate: F57 (= F80), K58 (= K81), N85 (= N108), G184 (= G207), G185 (= G208), G186 (= G209), G187 (= G210), G237 (= G260), E282 (= E305), S311 (= S338), G312 (= G339)
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
42% identity, 46% coverage: 57:305/547 of query aligns to 32:280/326 of 2gn2A
- active site: K56 (= K81), A81 (= A106), Q207 (≠ E232), V211 (≠ A236), G213 (≠ C238), G235 (= G260)
- binding cytidine-5'-monophosphate: R51 (≠ P76), T52 (≠ V77), G53 (≠ H78), A114 (= A139), D117 (≠ R142), Y118 (≠ L143)
Sites not aligning to the query:
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
34% identity, 54% coverage: 51:344/547 of query aligns to 38:329/339 of Q7XSN8
- E219 (= E232) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ C238) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
33% identity, 57% coverage: 41:351/547 of query aligns to 3:315/319 of A4F2N8
- K53 (= K81) mutation to A: Loss of enzymatic activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
34% identity, 55% coverage: 48:349/547 of query aligns to 19:312/318 of 1wtcA
- active site: K52 (= K81), S77 (≠ A106), E203 (= E232), G207 (≠ A236), D209 (≠ C238), G231 (= G260), I302 (≠ L337), S303 (= S338)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ K49), K47 (≠ P76), M48 (≠ V77), A109 (≠ D138), A110 (= A139), Y114 (≠ L143)
- binding magnesium ion: E203 (= E232), G207 (≠ A236), D209 (≠ C238)
- binding pyridoxal-5'-phosphate: F51 (= F80), K52 (= K81), N79 (= N108), G178 (= G207), G179 (= G208), G180 (= G209), G181 (= G210), G231 (= G260), E276 (= E305), T278 (≠ A307), S303 (= S338)
1v71A Crystal structure of s.Pombe serine racemase
34% identity, 55% coverage: 48:349/547 of query aligns to 19:312/318 of 1v71A
- active site: K52 (= K81), S77 (≠ A106), E203 (= E232), G207 (≠ A236), D209 (≠ C238), G231 (= G260), I302 (≠ L337), S303 (= S338)
- binding magnesium ion: E203 (= E232), G207 (≠ A236), D209 (≠ C238)
- binding pyridoxal-5'-phosphate: F51 (= F80), K52 (= K81), N79 (= N108), G178 (= G207), G179 (= G208), G180 (= G209), G181 (= G210), G231 (= G260), E276 (= E305), T278 (≠ A307), S303 (= S338), G304 (= G339)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
34% identity, 55% coverage: 48:349/547 of query aligns to 20:313/319 of 2zr8A
- active site: K53 (= K81), S78 (≠ A106), E204 (= E232), G208 (≠ A236), D210 (≠ C238), G232 (= G260), I303 (≠ L337), S304 (= S338)
- binding magnesium ion: E204 (= E232), G208 (≠ A236), D210 (≠ C238)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F80), K53 (= K81), S77 (= S105), S78 (≠ A106), N80 (= N108), H81 (= H109), P147 (= P175), G179 (= G207), G180 (= G208), G181 (= G209), G182 (= G210), G232 (= G260), E277 (= E305), T279 (≠ A307), S304 (= S338)
- binding serine: S78 (≠ A106), R129 (≠ A157), D231 (= D259), G232 (= G260), A233 (≠ V261), Q234 (≠ A262), T235 (≠ V263)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
34% identity, 55% coverage: 48:349/547 of query aligns to 20:313/319 of 2zpuA
- active site: K53 (= K81), S78 (≠ A106), E204 (= E232), G208 (≠ A236), D210 (≠ C238), G232 (= G260), I303 (≠ L337), S304 (= S338)
- binding magnesium ion: E204 (= E232), G208 (≠ A236), D210 (≠ C238)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F80), K53 (= K81), S77 (= S105), S78 (≠ A106), N80 (= N108), H81 (= H109), P147 (= P175), G179 (= G207), G180 (= G208), G181 (= G209), G182 (= G210), G232 (= G260), E277 (= E305), T279 (≠ A307), S304 (= S338)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 55% coverage: 48:349/547 of query aligns to 24:317/323 of O59791
- S82 (≠ A106) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
33% identity, 56% coverage: 43:346/547 of query aligns to 16:314/322 of 3l6bA
- active site: K54 (= K81), S77 (≠ A106), E203 (= E232), A207 (= A236), D209 (≠ A237), G232 (= G260), T278 (≠ A307), L305 (= L337), S306 (= S338)
- binding malonate ion: K54 (= K81), S76 (= S105), S77 (≠ A106), N79 (= N108), H80 (= H109), R128 (≠ A157), G232 (= G260)
- binding manganese (ii) ion: E203 (= E232), A207 (= A236), D209 (≠ A237)
- binding pyridoxal-5'-phosphate: F53 (= F80), K54 (= K81), N79 (= N108), G178 (= G207), G179 (= G208), G180 (= G209), G181 (= G210), M182 (≠ L211), V233 (= V261), E276 (= E305), T278 (≠ A307), S306 (= S338), G307 (= G339)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
33% identity, 56% coverage: 43:346/547 of query aligns to 15:318/320 of 7nbhAAA
- active site: K53 (= K81), S81 (≠ A106), E207 (= E232), A211 (= A236), D213 (≠ A237), G236 (= G260), L309 (= L337), S310 (= S338)
- binding calcium ion: E207 (= E232), A211 (= A236), D213 (≠ A237)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A106), G85 (≠ A110), Q86 (= Q111), K111 (= K136), I115 (≠ V140), Y118 (≠ L143), D235 (= D259), P281 (= P306), N313 (= N341), V314 (= V342), D315 (≠ N343)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
33% identity, 56% coverage: 43:346/547 of query aligns to 15:318/323 of 7nbfAAA
- active site: K53 (= K81), S81 (≠ A106), E207 (= E232), A211 (= A236), D213 (≠ A237), G236 (= G260), L309 (= L337), S310 (= S338)
- binding calcium ion: E207 (= E232), A211 (= A236), D213 (≠ A237)
- binding magnesium ion: N244 (≠ E269)
- binding pyridoxal-5'-phosphate: F52 (= F80), K53 (= K81), N83 (= N108), G182 (= G207), G183 (= G208), G184 (= G209), G185 (= G210), M186 (≠ L211), G236 (= G260), V237 (= V261), T282 (≠ A307), S310 (= S338), G311 (= G339)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ K49), L22 (≠ V50), T23 (= T51), P24 (= P52), L26 (vs. gap), T27 (vs. gap), F46 (≠ M74)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
33% identity, 56% coverage: 43:346/547 of query aligns to 15:318/323 of 7nbdAAA
- active site: K53 (= K81), S81 (≠ A106), E207 (= E232), A211 (= A236), D213 (≠ A237), G236 (= G260), L309 (= L337), S310 (= S338)
- binding calcium ion: E207 (= E232), A211 (= A236), D213 (≠ A237)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ F297), L278 (≠ I303), V314 (= V342), L316 (≠ F344)
- binding magnesium ion: N244 (≠ E269)
- binding pyridoxal-5'-phosphate: F52 (= F80), K53 (= K81), N83 (= N108), G182 (= G207), G183 (= G208), G184 (= G209), G185 (= G210), M186 (≠ L211), G236 (= G260), V237 (= V261), E280 (= E305), T282 (≠ A307), S310 (= S338), G311 (= G339)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
33% identity, 56% coverage: 43:346/547 of query aligns to 15:318/323 of 7nbcCCC
- active site: K53 (= K81), S81 (≠ A106), E207 (= E232), A211 (= A236), D213 (≠ A237), G236 (= G260), L309 (= L337), S310 (= S338)
- binding biphenyl-4-ylacetic acid: T78 (≠ C103), H79 (≠ A104), H84 (= H109), V148 (≠ I173), H149 (≠ A174), P150 (= P175)
- binding calcium ion: E207 (= E232), A211 (= A236), D213 (≠ A237)
- binding pyridoxal-5'-phosphate: F52 (= F80), K53 (= K81), N83 (= N108), G182 (= G207), G183 (= G208), G184 (= G209), G185 (= G210), M186 (≠ L211), G236 (= G260), V237 (= V261), T282 (≠ A307), S310 (= S338), G311 (= G339)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
33% identity, 56% coverage: 43:346/547 of query aligns to 15:318/323 of 7nbcAAA
- active site: K53 (= K81), S81 (≠ A106), E207 (= E232), A211 (= A236), D213 (≠ A237), G236 (= G260), L309 (= L337), S310 (= S338)
- binding calcium ion: E207 (= E232), A211 (= A236), D213 (≠ A237)
- binding magnesium ion: N244 (≠ E269)
- binding pyridoxal-5'-phosphate: F52 (= F80), K53 (= K81), N83 (= N108), G182 (= G207), G183 (= G208), G184 (= G209), G185 (= G210), M186 (≠ L211), G236 (= G260), V237 (= V261), T282 (≠ A307), S310 (= S338), G311 (= G339)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
33% identity, 56% coverage: 43:346/547 of query aligns to 15:318/322 of 7nbgAAA
- active site: K53 (= K81), S81 (≠ A106), E207 (= E232), A211 (= A236), D213 (≠ A237), G236 (= G260), L309 (= L337), S310 (= S338)
- binding calcium ion: E207 (= E232), A211 (= A236), D213 (≠ A237)
- binding pyridoxal-5'-phosphate: F52 (= F80), K53 (= K81), N83 (= N108), G182 (= G207), G183 (= G208), G184 (= G209), G185 (= G210), M186 (≠ L211), G236 (= G260), V237 (= V261), T282 (≠ A307), S310 (= S338), G311 (= G339)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A106), G85 (≠ A110), Q86 (= Q111), I101 (= I126), K111 (= K136), I115 (≠ V140), Y118 (≠ L143)
6zspAAA serine racemase bound to atp and malonate. (see paper)
33% identity, 56% coverage: 43:346/547 of query aligns to 15:311/320 of 6zspAAA
- active site: K53 (= K81), S74 (≠ A106), E200 (= E232), A204 (= A236), D206 (≠ A237), G229 (= G260), L302 (= L337), S303 (= S338)
- binding adenosine-5'-triphosphate: S28 (vs. gap), S29 (= S54), I30 (≠ S55), K48 (≠ P76), T49 (≠ V77), Q79 (= Q111), Y111 (≠ L143), E266 (= E298), R267 (≠ D299), K269 (≠ R301), N306 (= N341)
- binding magnesium ion: E200 (= E232), A204 (= A236), D206 (≠ A237)
- binding malonate ion: K53 (= K81), S73 (= S105), S74 (≠ A106), N76 (= N108), H77 (= H109), R125 (≠ A157), G229 (= G260), S232 (≠ K264)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
33% identity, 55% coverage: 43:343/547 of query aligns to 15:310/310 of 7nbgDDD
- active site: K53 (= K81), S76 (≠ A106), E202 (= E232), A206 (= A236), D208 (≠ A237), G231 (= G260), L304 (= L337), S305 (= S338)
- binding calcium ion: E202 (= E232), A206 (= A236), D208 (≠ A237)
- binding magnesium ion: N239 (≠ E269)
- binding ortho-xylene: S76 (≠ A106), Q81 (= Q111), I96 (= I126), Y113 (≠ L143)
- binding pyridoxal-5'-phosphate: F52 (= F80), K53 (= K81), N78 (= N108), G177 (= G207), G178 (= G208), G179 (= G209), G180 (= G210), M181 (≠ L211), G231 (= G260), V232 (= V261), E275 (= E305), T277 (≠ A307), S305 (= S338), G306 (= G339)
Sites not aligning to the query:
5cvcA Structure of maize serine racemase (see paper)
33% identity, 54% coverage: 51:347/547 of query aligns to 22:316/329 of 5cvcA
- active site: K52 (= K81), S77 (≠ A106), E203 (= E232), A207 (= A236), D209 (≠ C238), G231 (= G260), V306 (≠ L337), S307 (= S338)
- binding magnesium ion: E203 (= E232), A207 (= A236), D209 (≠ C238)
- binding pyridoxal-5'-phosphate: F51 (= F80), K52 (= K81), N79 (= N108), S178 (≠ G207), G179 (= G208), G180 (= G209), G181 (= G210), L232 (≠ V261), E275 (= E305), S307 (= S338), G308 (= G339)
Query Sequence
>7023121 FitnessBrowser__ANA3:7023121
MLSLASSQTEQAEAQASQSKPGTSALEKSQLAQSYLQKILLSSVYDVAKVTPLSSLNKLS
ARLGCQVFLKREDMQPVHSFKLRGAYNRIAQLSQAECQRGVVCASAGNHAQGVAMSAASR
GVDAVIVMPETTPDIKVDAVRRLGGNVVLHGQAFDQANGFAMEMAKLEGRVYIAPFDDEA
VIAGQGTIAQEMLQQQRDLEVVFVPVGGGGLIAGIAAYYKAVMPQVKIVGVEPEDAACLK
AAMEAGEPVTLAQVGLFADGVAVKRIGTEPFRLAKWFVDEVVTVTSDEICAAVKDIFEDT
RAIAEPAGALSLAGLKKYVSTNAAGESGKGEKVAAILSGANVNFHSLRYVSERCELGEQK
EAVLAVKVPERPGSFLRFCELLEKRVMTEFNYRFSSRDMAVVFAGIRLTKGHGELEQIIN
TLEDNGFEVQDLSGDETAKLHVRYMVGGHPPEPLEERLFSFEFPEHPGALLKFLTTLQSK
WNISLFHYRNHGAAFGRVLAGFEVPEGDALPFQQFLTELGFVYQEETQSPAYQLFLNAGK
GKKSLPL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory