SitesBLAST
Comparing 7023412 FitnessBrowser__ANA3:7023412 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
33% identity, 94% coverage: 16:406/416 of query aligns to 19:418/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ V44), F46 (≠ V44), P75 (≠ D73), L91 (≠ V90), F95 (≠ V94), L130 (= L130), I133 (≠ L133), I159 (≠ L159), Y167 (≠ S167), K196 (= K188), G200 (≠ V192), I207 (≠ Y199), F210 (= F202), L250 (≠ A242), I262 (≠ R255), M269 (≠ V262), T334 (= T328), V335 (≠ S329), G336 (≠ E330), T340 (≠ S334), L343 (≠ F337), M399 (≠ S387)
- binding aspartic acid: S277 (= S270), S278 (= S271), T314 (≠ V308), G354 (= G348), A358 (≠ G352), G359 (= G353), D394 (= D382), R397 (≠ L385), T398 (= T386)
- binding sodium ion: Y89 (= Y88), T92 (≠ N91), S93 (≠ T92), G306 (= G300), T308 (= T302), N310 (= N304), N310 (= N304), M311 (= M305), D312 (≠ G306), S349 (= S343), I350 (≠ V344), T352 (≠ A346), N401 (= N389), V402 (= V390), D405 (= D393)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
33% identity, 94% coverage: 16:404/416 of query aligns to 16:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G67), V83 (≠ F85), I157 (≠ M160), Y164 (≠ S167), K193 (= K188), T305 (= T302), I306 (≠ M303), I347 (≠ V344)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: M199 (= M194), S275 (= S271), T311 (≠ V308), G356 (= G353), L384 (≠ A375), D391 (= D382), R394 (≠ L385)
Sites not aligning to the query:
2nwwA Crystal structure of gltph in complex with tboa (see paper)
33% identity, 94% coverage: 16:404/416 of query aligns to 10:407/407 of 2nwwA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
33% identity, 94% coverage: 16:404/416 of query aligns to 11:408/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
33% identity, 94% coverage: 16:404/416 of query aligns to 11:408/408 of 6bauA
- binding cysteine: S270 (= S271), M303 (= M305), T306 (≠ V308), A345 (≠ G347), G346 (= G348), V347 (= V349), G351 (= G353), D386 (= D382), C389 (≠ L385), T390 (= T386), N393 (= N389)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
33% identity, 94% coverage: 16:404/416 of query aligns to 19:416/425 of O59010
- S65 (= S63) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A269) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 269:271) binding
- M311 (= M305) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ V308) binding
- V355 (= V349) binding
- D394 (= D382) binding
- M395 (= M383) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (≠ L385) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N389) binding
- D405 (= D393) mutation to N: Strongly decreased affinity for aspartate.
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
33% identity, 98% coverage: 8:415/416 of query aligns to 13:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
33% identity, 98% coverage: 8:415/416 of query aligns to 13:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ A269), S275 (= S270), S276 (= S271), T313 (≠ V308), G353 (= G348), V354 (= V349), A357 (≠ G352), G358 (= G353), D394 (= D382), R397 (≠ L385), T398 (= T386)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K188), G198 (≠ V192), Y202 (≠ L196)
- binding sodium ion: Y87 (= Y88), T90 (≠ N91), S91 (≠ T92), S276 (= S271), G305 (= G300), A306 (= A301), T307 (= T302), N309 (= N304), N309 (= N304), M310 (= M305), D311 (≠ G306), S348 (= S343), I349 (≠ V344), G350 (= G345), T351 (≠ A346), N401 (= N389), V402 (= V390), D405 (= D393)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
33% identity, 98% coverage: 8:415/416 of query aligns to 10:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K188), G195 (≠ V192), R282 (= R280)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A269), S272 (= S270), S273 (= S271), M307 (= M305), T310 (≠ V308), G353 (= G351), A354 (≠ G352), R394 (≠ L385), T395 (= T386)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
33% identity, 98% coverage: 8:415/416 of query aligns to 11:421/425 of 6zgbA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
33% identity, 98% coverage: 8:415/416 of query aligns to 6:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A269), S265 (= S271), M299 (= M305), T302 (≠ V308), T340 (≠ A346), G342 (= G348), V343 (= V349), G347 (= G353), D383 (= D382), R386 (≠ L385), T387 (= T386), N390 (= N389)
- binding decyl-beta-d-maltopyranoside: H23 (≠ Y25), V212 (≠ F217), A216 (≠ L221)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
31% identity, 94% coverage: 16:404/416 of query aligns to 11:396/396 of 6bmiA
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
29% identity, 91% coverage: 15:393/416 of query aligns to 27:449/503 of Q10901
- N177 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
29% identity, 96% coverage: 16:415/416 of query aligns to 18:424/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S270), S281 (= S271), T318 (≠ V308), G363 (= G353), M367 (≠ I357), V385 (≠ A375), D388 (= D378), R395 (≠ L385), T396 (= T386)
- binding dodecyl beta-D-glucopyranoside: V19 (≠ L17), I20 (= I18), W389 (≠ R379)
- binding cholesterol hemisuccinate: R80 (= R79), R84 (≠ K83), I95 (≠ V94), I252 (≠ A242)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
29% identity, 96% coverage: 16:415/416 of query aligns to 17:425/425 of 7xr4A
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
28% identity, 89% coverage: 45:415/416 of query aligns to 57:412/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ F77), G89 (= G78), G92 (= G81), A95 (≠ T84), V96 (≠ F85), Y99 (= Y88), M163 (≠ L159), F167 (≠ G163), F293 (= F295), V297 (≠ L299)
- binding aspartic acid: S268 (= S270), S269 (= S271), T306 (≠ V308), G346 (= G348), I347 (≠ V349), A350 (≠ G352), G351 (= G353), D380 (= D382), R383 (≠ L385), T384 (= T386)
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
29% identity, 94% coverage: 16:407/416 of query aligns to 10:402/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (= S63), L58 (≠ I64), L65 (= L71), V339 (= V344), G340 (= G345), S343 (≠ G348), I344 (≠ V349)
- binding cholesterol: W188 (≠ S195), I227 (≠ L232), F250 (≠ R255), W257 (≠ V262), M379 (≠ V384), S382 (= S387)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S271), M300 (= M305), T303 (≠ V308), Y306 (= Y311), G348 (= G353), L349 (≠ M354), M352 (≠ I357), I366 (≠ F371), L369 (≠ V374), V370 (≠ A375), D373 (= D378), D377 (= D382), R380 (≠ L385), T381 (= T386), N384 (= N389)
Sites not aligning to the query:
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
29% identity, 84% coverage: 45:393/416 of query aligns to 79:467/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
27% identity, 96% coverage: 16:416/416 of query aligns to 53:520/573 of P31596
- K298 (= K207) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (≠ W234) mutation H->N,T,K,R: No transporter activity.
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
27% identity, 96% coverage: 16:416/416 of query aligns to 53:507/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
Query Sequence
>7023412 FitnessBrowser__ANA3:7023412
MIKSLSTRIFIGLFAGLILGTLVQYFLNDIGFFSGNLVELAGGVGTMFVNMIMMLVVPLV
FVSIVCGVCELQDLKSFGRLGGKTFGFYIVNTLVAISTALLVVLLLDPGKGVDMSSTDGV
AITATELPSLMALLIDIVPRNPVAAFMSGNMLQVIFMALMLGGVIKSLGEHVAGAVQGFQ
TANKIMMKLISVVMSLAPYGVFALMFKLGATLDAAVFISVLEYVVIILALLLLWIFVVYP
LAVGFFTPISAKSFREKTQEQVLFSLSTASSNATIPVTMRTLTEKLGVNRAVAGFGVPLG
ATMNMGGVAIYITIAIFFVANAFGMPITSEQLPSLLFSIFLLSVGAGGVPGGGMVMIGVL
IHQMGLPIEAFAIVAALDRIIDMVLTSCNVVGDTAVLTIVDQTEKTHQVELVDSES
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory