Comparing 7023440 FitnessBrowser__ANA3:7023440 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
O31645 PTS system mannose-specific EIIBCA component; EIIBCA-Man; EII-Man; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see 2 papers)
27% identity, 98% coverage: 2:145/147 of query aligns to 501:646/650 of O31645
Sites not aligning to the query:
O31644 Transcriptional regulator ManR; Mannose operon transcriptional activator; EC 2.7.1.191 from Bacillus subtilis (strain 168) (see paper)
37% identity, 51% coverage: 48:122/147 of query aligns to 552:626/648 of O31644
Sites not aligning to the query:
>7023440 FitnessBrowser__ANA3:7023440
MELRTILRPECTTCATPGSKKKVLELISDLAAAQYPTLSSQEIFESLVAREKMGSTGIGN
GIAIPHGRLTDITQPIAILVKCEEPIAFDAIDKQPVDILFALLVPADQCQQHLSTLSCMA
EKLSDKQILKQLRKTHDETELYQVITG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory