Comparing 7023443 Shewana3_0673 ABC transporter related (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
78% identity, 98% coverage: 6:243/243 of query aligns to 3:240/240 of 6mjpA
6mbnA Lptb e163q in complex with atp (see paper)
74% identity, 98% coverage: 5:243/243 of query aligns to 3:241/241 of 6mbnA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
74% identity, 98% coverage: 5:241/243 of query aligns to 2:238/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
74% identity, 98% coverage: 5:241/243 of query aligns to 2:238/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
74% identity, 96% coverage: 5:238/243 of query aligns to 2:235/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
74% identity, 96% coverage: 5:237/243 of query aligns to 2:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
74% identity, 96% coverage: 5:237/243 of query aligns to 2:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
74% identity, 95% coverage: 5:236/243 of query aligns to 2:233/233 of 6b8bA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
36% identity, 98% coverage: 1:238/243 of query aligns to 2:238/240 of 1ji0A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 98% coverage: 2:239/243 of query aligns to 1:254/254 of 1g6hA
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
32% identity, 93% coverage: 2:226/243 of query aligns to 1:228/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
32% identity, 93% coverage: 2:226/243 of query aligns to 1:228/263 of 7d08B
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 98% coverage: 2:238/243 of query aligns to 1:253/253 of 1g9xB
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
31% identity, 91% coverage: 6:226/243 of query aligns to 3:226/253 of 6z5uK
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 91% coverage: 8:227/243 of query aligns to 4:224/240 of 4ymuJ
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
33% identity, 90% coverage: 9:226/243 of query aligns to 8:223/285 of 4yerA
3c4jA Abc protein artp in complex with atp-gamma-s
33% identity, 91% coverage: 11:231/243 of query aligns to 9:230/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
33% identity, 91% coverage: 11:231/243 of query aligns to 9:230/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
33% identity, 91% coverage: 11:231/243 of query aligns to 9:230/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
33% identity, 91% coverage: 11:231/243 of query aligns to 9:230/242 of 2oljA
>7023443 Shewana3_0673 ABC transporter related (RefSeq)
MTQITLKAQNLAKSYKSRQVVKDVSLTVKTGQVVGLLGPNGAGKTTTFYMVVGLVKSDKG
HIFIDDDDLTADPMHLRARKGIGYLPQEASIFRKLTVHDNIMAVLQTRKELNRDQREEEL
EHLLEEFHITHIRDSQGMSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKK
IIEQLKSRGLGVLITDHNVRETLDVCEHAYIVSHGNLIAEGTPAEILDNQQVRAVYLGEQ
FRL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory