SitesBLAST
Comparing 7023484 FitnessBrowser__ANA3:7023484 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2rjhA Crystal structure of biosynthetic alaine racemase in d-cycloserine- bound form from escherichia coli (see paper)
58% identity, 97% coverage: 9:355/358 of query aligns to 8:355/359 of 2rjhA
- active site: K34 (= K35), R129 (= R130), H159 (= H160), R209 (= R210), Y255 (= Y255), A302 (≠ S302), D304 (= D304)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K34 (= K35), Y38 (= Y39), R129 (= R130), H159 (= H160), A193 (≠ N194), S194 (= S195), R209 (= R210), G211 (= G212), I212 (= I213), Y255 (= Y255), A302 (≠ S302), M303 (= M303), Y343 (= Y343)
P0A6B4 Alanine racemase, biosynthetic; EC 5.1.1.1 from Escherichia coli (strain K12) (see paper)
58% identity, 97% coverage: 9:355/358 of query aligns to 8:355/359 of P0A6B4
- K34 (= K35) modified: N6-(pyridoxal phosphate)lysine
- K122 (= K123) modified: N6-carboxylysine
- D164 (= D165) mutation to A: Slightly reduces affinity for D-Ala and L-Ala.; mutation to K: Reduces catalytic activity. Slightly reduces affinity for D-Ala and L-Ala.
- E165 (= E166) mutation to A: Slightly reduces affinity for D-Ala and L-Ala.; mutation to K: Reduces catalytic activity. Slightly reduces affinity for D-Ala and L-Ala.
- P219 (= P220) mutation to A: No effect on catalytic activity. No effect on affinity for D-Ala and L-Ala.
- E221 (≠ T222) mutation E->A,K,P: Slightly increases catalytic activity. Slightly increases affinity for D-Ala and L-Ala.
4xbjA Y274f alanine racemase from e. Coli inhibited by l-ala-p (see paper)
57% identity, 97% coverage: 9:355/358 of query aligns to 6:353/357 of 4xbjA
- active site: K32 (= K35), R127 (= R130), H157 (= H160), R207 (= R210), Y253 (= Y255), A300 (≠ S302), D302 (= D304)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: V30 (= V33), K32 (= K35), Y36 (= Y39), R127 (= R130), H157 (= H160), A191 (≠ N194), S192 (= S195), R207 (= R210), G209 (= G212), I210 (= I213), Y253 (= Y255), A300 (≠ S302), M301 (= M303), Y341 (= Y343)
3b8tA Crystal structure of escherichia coli alaine racemase mutant p219a (see paper)
57% identity, 97% coverage: 9:355/358 of query aligns to 8:355/359 of 3b8tA
- active site: K34 (= K35), R129 (= R130), H159 (= H160), R209 (= R210), Y255 (= Y255), A302 (≠ S302), D304 (= D304)
- binding pyridoxal-5'-phosphate: V32 (= V33), K34 (= K35), Y38 (= Y39), L78 (= L79), H159 (= H160), A193 (≠ N194), S194 (= S195), R209 (= R210), G211 (= G212), I212 (= I213), Y343 (= Y343)
Q9HTQ2 Alanine racemase, catabolic; EC 5.1.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
46% identity, 99% coverage: 1:353/358 of query aligns to 1:353/357 of Q9HTQ2
- K33 (= K35) modified: N6-(pyridoxal phosphate)lysine
- K122 (= K123) modified: N6-carboxylysine
1rcqA The 1.45 a crystal structure of alanine racemase from a pathogenic bacterium, pseudomonas aeruginosa, contains both internal and external aldimine forms (see paper)
46% identity, 99% coverage: 1:353/358 of query aligns to 1:353/357 of 1rcqA
- active site: K33 (= K35), R129 (= R130), H158 (= H160), R208 (= R210), Y253 (= Y255), S300 (= S302), D302 (= D304)
- binding d-lysine: K33 (= K35), R129 (= R130), Y341 (= Y343)
- binding pyridoxal-5'-phosphate: V31 (= V33), K33 (= K35), Y37 (= Y39), H158 (= H160), N192 (= N194), S193 (= S195), R208 (= R210), G210 (= G212), I211 (= I213), Y341 (= Y343)
6a2fA Crystal structure of biosynthetic alanine racemase from pseudomonas aeruginosa (see paper)
47% identity, 99% coverage: 1:353/358 of query aligns to 1:352/358 of 6a2fA
- active site: K34 (= K35), R130 (= R130), H159 (= H160), R209 (= R210), Y254 (= Y255), S301 (= S302), D303 (= D304)
- binding acetate ion: Y254 (= Y255), R279 (= R280), L340 (≠ I341), Y342 (= Y343)
- binding d-lysine: Y254 (= Y255), Y273 (= Y274), S301 (= S302), M302 (= M303), D303 (= D304), M304 (= M305)
- binding malonate ion: K123 (= K123), R130 (= R130), L131 (= L131)
6sczA Mycobacterium tuberculosis alanine racemase inhibited by dcs (see paper)
38% identity, 97% coverage: 7:353/358 of query aligns to 6:366/373 of 6sczA
- active site: K34 (= K35), R132 (= R130), H164 (= H160), R220 (= R210), Y263 (= Y255), C310 (≠ S302), D312 (= D304)
- binding (~{E})-[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylidene-[(4~{R})-3-oxidanylidene-1,2-oxazolidin-4-yl]azanium: K34 (= K35), Y38 (= Y39), W80 (≠ F82), H164 (= H160), S205 (= S195), R220 (= R210), G222 (= G212), I223 (= I213), Y356 (= Y343)
- binding [2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methyl-(3-oxidanyl-1,2-oxazol-4-yl)azanium: Y38 (= Y39), W80 (≠ F82), H164 (= H160), N204 (= N194), S205 (= S195), R220 (= R210), G222 (= G212), I223 (= I213), Y263 (= Y255), Y282 (= Y274), M311 (= M303), Y356 (= Y343)
- binding polyethylene glycol: D172 (≠ E168), A210 (≠ Y200), P212 (= P202)
P9WQA9 Alanine racemase; EC 5.1.1.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 97% coverage: 7:353/358 of query aligns to 14:374/384 of P9WQA9
- K42 (= K35) modified: N6-(pyridoxal phosphate)lysine
1xfcA The 1.9 a crystal structure of alanine racemase from mycobacterium tuberculosis contains a conserved entryway into the active site (see paper)
38% identity, 97% coverage: 7:353/358 of query aligns to 4:359/366 of 1xfcA
- active site: K32 (= K35), R130 (= R130), H162 (= H160), R213 (= R210), C303 (≠ S302), D305 (= D304)
- binding pyridoxal-5'-phosphate: K32 (= K35), Y36 (= Y39), W78 (≠ F82), H162 (= H160), S198 (= S195), R213 (= R210), G215 (= G212), I216 (= I213), Y349 (= Y343)
6q70A Crystal structure of the alanine racemase bsu17640 from bacillus subtilis in the presence of hepes (see paper)
34% identity, 97% coverage: 8:353/358 of query aligns to 11:374/386 of 6q70A
- active site: K39 (= K35), R139 (= R130), H169 (= H160), R225 (= R210), Y272 (= Y255), T319 (≠ S302), D321 (= D304)
- binding pyridoxal-5'-phosphate: V37 (= V33), K39 (= K35), Y43 (= Y39), L85 (= L79), R139 (= R130), H169 (= H160), T210 (≠ S195), R225 (= R210), G227 (= G212), I228 (= I213), Y364 (= Y343)
5irpA Crystal structure of the alanine racemase bsu17640 from bacillus subtilis (see paper)
34% identity, 97% coverage: 8:353/358 of query aligns to 11:374/386 of 5irpA
- active site: K39 (= K35), R139 (= R130), H169 (= H160), R225 (= R210), Y272 (= Y255), T319 (≠ S302), D321 (= D304)
- binding magnesium ion: L155 (= L145), K156 (≠ M146), S158 (≠ C148), L161 (≠ V151)
- binding 2-amino-2-hydroxymethyl-propane-1,3-diol: D174 (= D165), P235 (= P220), Y364 (= Y343)
- binding (5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: Y43 (= Y39), L85 (= L79), R139 (= R130), H169 (= H160), N209 (= N194), T210 (≠ S195), R225 (= R210), G227 (= G212), I228 (= I213), Y364 (= Y343)
3e5pB Crystal structure of alanine racemase from e.Faecalis (see paper)
35% identity, 97% coverage: 6:353/358 of query aligns to 10:366/371 of 3e5pB
- active site: K40 (= K35), R139 (= R130), H169 (= H160), R222 (= R210), Y267 (= Y255), C313 (≠ S302), D315 (= D304)
- binding pyridoxal-5'-phosphate: K40 (= K35), Y44 (= Y39), R139 (= R130), H169 (= H160), S207 (= S195), G224 (= G212), V225 (≠ I213), Y356 (= Y343)
3e6eA Crystal structure of alanine racemase from e.Faecalis complex with cycloserine (see paper)
35% identity, 97% coverage: 6:353/358 of query aligns to 9:365/370 of 3e6eA
- active site: K39 (= K35), R138 (= R130), H168 (= H160), R221 (= R210), Y266 (= Y255), C312 (≠ S302), D314 (= D304)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K39 (= K35), Y43 (= Y39), L85 (= L79), R138 (= R130), H168 (= H160), S206 (= S195), R221 (= R210), G223 (= G212), V224 (≠ I213), Y266 (= Y255), Y285 (= Y274), M313 (= M303), Y355 (= Y343)
1vfsA Crystal structure of d-cycloserine-bound form of alanine racemase from d-cycloserine-producing streptomyces lavendulae (see paper)
36% identity, 97% coverage: 7:353/358 of query aligns to 8:369/383 of 1vfsA
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K36 (= K35), Y40 (= Y39), W82 (≠ L79), R134 (= R130), H166 (= H160), S207 (= S195), R222 (= R210), G224 (= G212), Y268 (= Y255), Y287 (= Y274), M316 (= M303), Y359 (= Y343)
1vfhA Crystal structure of alanine racemase from d-cycloserine producing streptomyces lavendulae (see paper)
36% identity, 97% coverage: 7:353/358 of query aligns to 8:369/382 of 1vfhA
- active site: K36 (= K35), R134 (= R130), H166 (= H160), R222 (= R210), Y268 (= Y255), A315 (≠ S302), D317 (= D304)
- binding pyridoxal-5'-phosphate: K36 (= K35), Y40 (= Y39), W82 (≠ L79), H166 (= H160), S207 (= S195), R222 (= R210), G224 (= G212), L225 (≠ I213), Y359 (= Y343)
5fagA Alanine racemase from streptomyces coelicolor a3(2) with bound propionate inhibitor (see paper)
37% identity, 97% coverage: 6:353/358 of query aligns to 16:383/390 of 5fagA
- active site: I19 (= I9), K45 (= K35), A46 (= A36), R147 (= R130), H180 (= H160), R236 (= R210), Y282 (= Y255), A329 (≠ S302), D331 (= D304)
- binding pyridoxal-5'-phosphate: K45 (= K35), Y49 (= Y39), W95 (≠ R75), W178 (≠ M158), H180 (= H160), N220 (= N194), S221 (= S195), R236 (= R210), G238 (= G212), I239 (= I213), Y373 (= Y343)
5fajA Alanine racemase from streptomyces coelicolor a3(2) in complex with d- cycloserine (see paper)
37% identity, 97% coverage: 6:353/358 of query aligns to 11:378/385 of 5fajA
- active site: I14 (= I9), K40 (= K35), A41 (= A36), R142 (= R130), H175 (= H160), R231 (= R210), Y277 (= Y255), A324 (≠ S302), D326 (= D304)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K40 (= K35), Y44 (= Y39), W90 (≠ R75), W173 (≠ M158), H175 (= H160), N215 (= N194), S216 (= S195), R231 (= R210), P232 (= P211), G233 (= G212), I234 (= I213), Y277 (= Y255), Y296 (= Y274), M325 (= M303), Y368 (= Y343)
4y2wA Crystal structure of a thermostable alanine racemase from thermoanaerobacter tengcongensis mb4 (see paper)
30% identity, 97% coverage: 6:353/358 of query aligns to 10:370/388 of 4y2wA
- active site: K40 (= K35), R138 (= R130), H168 (= H160), R224 (= R210), Y268 (= Y255), C315 (≠ S302), D317 (= D304)
- binding alanine: Y268 (= Y255), Y287 (= Y274), C315 (≠ S302), M316 (= M303)
- binding phosphate ion: N208 (= N194), A209 (≠ S195), I227 (= I213)
7xllA Alanine racemase from lactobacillus sakei uonuma-1. (see paper)
33% identity, 95% coverage: 14:353/358 of query aligns to 22:370/378 of 7xllA
Sites not aligning to the query:
Query Sequence
>7023484 FitnessBrowser__ANA3:7023484
MKPFPRAEISSSALQNNLAVLRQQASRSQVMAVVKANGYGHGLLNVANCLHTADGFGLAR
LEEALELRAGGVKARLLLLEGFFRSTDLPLLVAHDIDTVVHHESQIEMLEQATLSKPVTV
WLKVDSGMHRLGVTPEQFTQVYARLMACDNVAKPIHLMTHFACADEPENHYTQVQMQTFN
QLTADLPGFRTLANSAGALYWPKSQGDWIRPGIALYGVSPVTGDCGANHGLIPAMNLVSR
LIAVRDHKAGQPVGYGCYWTAKQDTRLGVVAIGYGDGYPRNAPEGTPVWVNGRRVPIVGR
VSMDMLTVDLGADATDLVGDEALLWGAALPVEEVAEHIGTIAYELVTKLTPRVAVCLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory