Comparing 7023614 Shewana3_0843 hypothetical protein (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
3iehA Crystal structure of putative metallopeptidase (yp_001051774.1) from shewanella baltica os155 at 2.45 a resolution
95% identity, 97% coverage: 4:271/275 of query aligns to 1:268/268 of 3iehA
4okoA Crystal structure of francisella tularensis rep34 (rapid encystment phenotype protein 34 kda) (see paper)
30% identity, 32% coverage: 48:135/275 of query aligns to 56:143/290 of 4okoA
Sites not aligning to the query:
>7023614 Shewana3_0843 hypothetical protein (RefSeq)
MVSRSPFESFQWKSDIFNCESTDIDNFYLQLEQEMSRLGMVEKKLGEVGKYSVSLYQSPA
AKSGLPSLLISAGFHGEESAGPWGLLHFLSEASADLFERVNLSILPLVNPTGFKRGHRFN
KFGENPNRGFVFENGKPKANESTSVEGKLLLDHAQLLIAASRDGILTCHEDVLSRDAYVY
SFEPSQVPGRFSIDLRDTLGGYFPIAEDGEIDGCPVKDGLIFNHFDTSFEACLVRSGARV
GACTETPALQNFDQRVLANSAAMTHFLALCAPLCD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory