Comparing 7023651 Shewana3_0880 ABC transporter related (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
68% identity, 100% coverage: 1:240/241 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
68% identity, 100% coverage: 1:240/241 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
68% identity, 100% coverage: 1:240/241 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
68% identity, 100% coverage: 1:240/241 of query aligns to 3:242/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
63% identity, 100% coverage: 1:240/241 of query aligns to 1:240/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
63% identity, 100% coverage: 1:240/241 of query aligns to 2:240/241 of 4u00A
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
52% identity, 100% coverage: 2:241/241 of query aligns to 3:254/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
52% identity, 100% coverage: 2:241/241 of query aligns to 7:258/258 of P02915
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 100% coverage: 1:241/241 of query aligns to 1:246/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
40% identity, 100% coverage: 1:241/241 of query aligns to 2:247/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
40% identity, 100% coverage: 1:241/241 of query aligns to 2:247/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
40% identity, 100% coverage: 1:241/241 of query aligns to 2:247/344 of 3tuiC
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
43% identity, 89% coverage: 1:214/241 of query aligns to 1:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
43% identity, 89% coverage: 1:214/241 of query aligns to 1:223/230 of 1l2tA
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
38% identity, 98% coverage: 2:237/241 of query aligns to 11:253/257 of P0AAH0
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
40% identity, 88% coverage: 1:211/241 of query aligns to 3:218/226 of 5xu1B
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
40% identity, 90% coverage: 1:216/241 of query aligns to 2:219/227 of 8igqA
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
40% identity, 90% coverage: 1:216/241 of query aligns to 2:219/225 of 8iddA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
40% identity, 90% coverage: 1:216/241 of query aligns to 1:218/229 of A5U7B7
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
35% identity, 98% coverage: 2:236/241 of query aligns to 7:243/375 of 2d62A
>7023651 Shewana3_0880 ABC transporter related (RefSeq)
MINITNLHKSYGDNAVLKGINEHIRQGEVVSVIGPSGSGKSTFLRCINLLEKPTQGDIEI
EGQSITAKDACVDKLRQKVGMVFQNFNLFPHKTVLQNITLAPVSLKLMTQAEADNKALAL
LTQVGLQDKANAYPSSLSGGQKQRVAIARALAMEPDLMLFDEPTSALDPEMVGDVLDVMK
DLAQKGMTMVIVTHEMGFARDVSDRVIFMDGGYVVESNIPEELFTRPKEARTQSFLSKVL
R
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory