SitesBLAST
Comparing 7023699 FitnessBrowser__ANA3:7023699 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
28% identity, 80% coverage: 94:468/470 of query aligns to 22:401/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: R23 (≠ F95), G40 (≠ A112), L41 (≠ F113)
- binding 2-oxoglutaric acid: D213 (= D281), P214 (≠ V282), Y215 (= Y283), G216 (≠ Q284), E217 (= E285), G241 (= G309), T242 (≠ S310), I246 (≠ S314)
- binding (2E)-pent-2-enedioic acid: G40 (≠ A112), Y130 (≠ F202), N184 (= N252), R376 (= R443)
- binding glutamic acid: V22 (= V94), L131 (≠ Y203), V360 (≠ A427), A364 (≠ L431), R369 (≠ A436)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G176), S105 (≠ A177), Q106 (≠ M178), Y130 (≠ F202), N184 (= N252), D212 (= D280), P214 (≠ V282), Y215 (= Y283), T242 (≠ S310), S244 (= S312), K245 (= K313), R252 (= R320)
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
28% identity, 80% coverage: 94:468/470 of query aligns to 22:401/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: V22 (= V94), R23 (≠ F95), L131 (≠ Y203), Q135 (= Q207), A364 (≠ L431), R369 (≠ A436)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: R23 (≠ F95), G40 (≠ A112), Y130 (≠ F202), L131 (≠ Y203), A132 (≠ G204), N184 (= N252), R376 (= R443)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G176), S105 (≠ A177), Q106 (≠ M178), Y130 (≠ F202), V179 (≠ M247), N184 (= N252), D212 (= D280), P214 (≠ V282), Y215 (= Y283), T242 (≠ S310), S244 (= S312), K245 (= K313), R252 (= R320)
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
28% identity, 80% coverage: 94:468/470 of query aligns to 22:401/404 of 3aowC
- binding 2-oxoglutaric acid: R23 (≠ F95), Y70 (vs. gap), Y130 (≠ F202), L275 (= L342)
- binding pyridoxal-5'-phosphate: G104 (= G176), S105 (≠ A177), Q106 (≠ M178), Y130 (≠ F202), V179 (≠ M247), N184 (= N252), D212 (= D280), P214 (≠ V282), Y215 (= Y283), T242 (≠ S310), S244 (= S312), K245 (= K313), R252 (= R320)
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
28% identity, 80% coverage: 94:468/470 of query aligns to 22:401/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G176), S105 (≠ A177), Q106 (≠ M178), Y130 (≠ F202), V179 (≠ M247), N184 (= N252), D212 (= D280), P214 (≠ V282), Y215 (= Y283), T242 (≠ S310), S244 (= S312), K245 (= K313), R252 (= R320)
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
28% identity, 79% coverage: 94:466/470 of query aligns to 18:387/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: I18 (≠ V94), R19 (≠ F95), G35 (≠ S111), G36 (≠ A112), G95 (= G176), S96 (≠ A177), Q97 (≠ M178), Y121 (≠ F202), N170 (= N252), D198 (= D280), Y201 (= Y283), S231 (= S310), S233 (= S312), K234 (= K313), R241 (= R320), R364 (= R443)
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
28% identity, 79% coverage: 94:466/470 of query aligns to 18:387/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G176), S96 (≠ A177), Q97 (≠ M178), Y121 (≠ F202), N170 (= N252), D198 (= D280), A200 (≠ V282), Y201 (= Y283), S231 (= S310), S233 (= S312), K234 (= K313), R241 (= R320)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
28% identity, 79% coverage: 94:466/470 of query aligns to 22:391/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: I22 (≠ V94), R23 (≠ F95), G39 (≠ S111), G40 (≠ A112), G99 (= G176), S100 (≠ A177), Q101 (≠ M178), Y125 (≠ F202), N174 (= N252), D202 (= D280), Y205 (= Y283), S235 (= S310), S237 (= S312), K238 (= K313), R245 (= R320), R368 (= R443)
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
28% identity, 79% coverage: 94:466/470 of query aligns to 22:391/397 of Q72LL6
- R23 (≠ F95) mutation to A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; mutation to Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
- G40 (≠ A112) binding
- Y70 (≠ D142) binding
- N174 (= N252) binding ; binding
- R245 (= R320) binding
- R368 (= R443) binding
Sites not aligning to the query:
- 20 S→E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
26% identity, 80% coverage: 94:468/470 of query aligns to 19:399/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G176), S103 (≠ A177), Q104 (≠ M178), Y128 (≠ F202), V177 (≠ M247), N182 (= N252), D210 (= D280), P212 (≠ V282), Y213 (= Y283), T240 (≠ S310), S242 (= S312), K243 (= K313), R250 (= R320)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
29% identity, 77% coverage: 105:466/470 of query aligns to 25:383/389 of 2z1yA
- binding leucine: G32 (≠ A112), Y117 (≠ F202), R360 (= R443)
- binding pyridoxal-5'-phosphate: G91 (= G176), S92 (≠ A177), Q93 (≠ M178), Y117 (≠ F202), N166 (= N252), D194 (= D280), Y197 (= Y283), S227 (= S310), S229 (= S312), K230 (= K313), R237 (= R320)
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
25% identity, 77% coverage: 101:464/470 of query aligns to 31:400/405 of 2zc0A
- active site: Y132 (≠ F202), D214 (= D280), A216 (≠ V282), S246 (= S312)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G176), G107 (≠ A177), T108 (≠ M178), Y132 (≠ F202), N186 (= N252), D214 (= D280), A216 (≠ V282), Y217 (= Y283), T244 (≠ S310), S246 (= S312), K247 (= K313), R254 (= R320)
8tn3A Structure of s. Hygroscopicus aminotransferase mppq complexed with pyridoxamine 5'-phosphate (pmp) (see paper)
29% identity, 72% coverage: 96:434/470 of query aligns to 11:358/388 of 8tn3A
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
23% identity, 79% coverage: 96:465/470 of query aligns to 30:410/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G176), S113 (≠ A177), Q114 (≠ M178), Y138 (≠ F202), N194 (= N252), D222 (= D280), P224 (≠ V282), Y225 (= Y283), T252 (≠ S310), S254 (= S312), K255 (= K313), R262 (= R320)
1v2fA Crystal structure of t.Th hb8 glutamine aminotransferase complex with 3-phenylpropionate (see paper)
30% identity, 71% coverage: 101:432/470 of query aligns to 22:336/368 of 1v2fA
- active site: F112 (= F202), A181 (≠ L270), A183 (≠ E272), K222 (= K313)
- binding hydrocinnamic acid: Q32 (≠ S111), G33 (≠ A112), Y57 (≠ M135), F112 (= F202), F253 (≠ L342)
- binding pyridoxal-5'-phosphate: G86 (= G176), A87 (= A177), T88 (≠ M178), F112 (= F202), N163 (= N252), D191 (= D280), V193 (= V282), Y194 (= Y283), S219 (= S310), K222 (= K313), R230 (= R320)
Sites not aligning to the query:
1v2eA Crystal structure of t.Th hb8 glutamine aminotransferase complex with a-keto-g-methylthiobutyrate (see paper)
30% identity, 71% coverage: 101:432/470 of query aligns to 22:336/368 of 1v2eA
- active site: F112 (= F202), A181 (≠ L270), A183 (≠ E272), K222 (= K313)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: Q32 (≠ S111), G33 (≠ A112), F112 (= F202), K222 (= K313), F309 (= F401)
- binding pyridoxal-5'-phosphate: G86 (= G176), A87 (= A177), T88 (≠ M178), F112 (= F202), D191 (= D280), V193 (= V282), Y194 (= Y283), S219 (= S310), K222 (= K313), R230 (= R320)
Sites not aligning to the query:
4ge4A Kynurenine aminotransferase ii inhibitors (see paper)
25% identity, 64% coverage: 170:468/470 of query aligns to 104:418/422 of 4ge4A
- binding (5-hydroxy-4-{[(1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G110 (= G176), S111 (≠ A177), Q112 (≠ M178), Y136 (≠ F202), N196 (= N252), D224 (= D280), P226 (≠ V282), Y227 (= Y283), S254 (= S310), S256 (= S312), K257 (= K313), R264 (= R320), R393 (= R443)
Sites not aligning to the query:
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
25% identity, 64% coverage: 170:468/470 of query aligns to 110:424/428 of 4gebA
- binding (5-hydroxy-4-{[(7-hydroxy-6-oxo-2-phenyl-6,7-dihydro-2H-pyrazolo[3,4-b]pyridin-5-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: S117 (≠ A177), Q118 (≠ M178), Y142 (≠ F202), N202 (= N252), D230 (= D280), P232 (≠ V282), Y233 (= Y283), S260 (= S310), S262 (= S312), K263 (= K313), R270 (= R320), R399 (= R443)
Sites not aligning to the query:
4ge9A Kynurenine aminotransferase ii inhibitors (see paper)
25% identity, 64% coverage: 170:468/470 of query aligns to 110:424/428 of 4ge9A
- binding (4-{[(6-benzyl-1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: S117 (≠ A177), Q118 (≠ M178), Y142 (≠ F202), N202 (= N252), D230 (= D280), P232 (≠ V282), Y233 (= Y283), S260 (= S310), S262 (= S312), R270 (= R320), L293 (= L342), R399 (= R443)
Sites not aligning to the query:
4ge7A Kynurenine aminotransferase ii inhibitors (see paper)
25% identity, 64% coverage: 170:468/470 of query aligns to 110:424/428 of 4ge7A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-6-phenoxy-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: S117 (≠ A177), Q118 (≠ M178), Y142 (≠ F202), N202 (= N252), D230 (= D280), P232 (≠ V282), Y233 (= Y283), S260 (= S310), S262 (= S312), R270 (= R320), L293 (= L342), R399 (= R443)
Sites not aligning to the query:
4gdyB Kynurenine aminotransferase ii inhibitors
25% identity, 64% coverage: 170:468/470 of query aligns to 110:424/428 of 4gdyB
- binding (5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: G116 (= G176), S117 (≠ A177), Q118 (≠ M178), Y142 (≠ F202), N202 (= N252), D230 (= D280), P232 (≠ V282), S260 (= S310), S262 (= S312), R270 (= R320), R399 (= R443)
Sites not aligning to the query:
Query Sequence
>7023699 FitnessBrowser__ANA3:7023699
MSKYQQLAQDLKNRISQGVWQAGDKLPSLRQTVTDSGLSLMTVLNAYQLLESQGVILAQA
KSGYIVAPQPEAFRYPETQRQIYFSDRLDINEFVFNVLQASKQAGIVPFGSAFPDPSLFP
QQALARSLVKVTRQMSPSFAADNLPPGNAGLRKAISQRYAKLGMSVAPDEILITSGAMEA
LNLSLAALAQAGDWVVIESPTFYGAMQAIERLKLRAIAVATDPREGIDLNALAEVLKTYP
VKACWLMSLHQNPLGCSLSDQKKQAVYQLLCEHNVSLIEDDVYQELYVGSSAPRPIKALD
TQGCVLHCGSFSKSLIAGYRVGWVAAGRHAPQLQRLQLMSTLSTSAPMQLAIADFIQSPQ
YERHLKRLRHTLADRKFAMYQLLRAHLPESVSVNFEPGGYFLWLALPSHMDATQIYHSAL
ERGISIAPGNLFSNQAEFRHFMRINASYDCSPELVRAVKALAQILEHSPN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory