SitesBLAST
Comparing 7023700 FitnessBrowser__ANA3:7023700 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7kb1C Complex of o-acety-l-homoserine aminocarboxypropyltransferase (mety) from thermotoga maritima and a key reaction intermediate (see paper)
57% identity, 98% coverage: 7:428/430 of query aligns to 11:426/428 of 7kb1C
- binding pyridoxal-5'-phosphate: Y57 (= Y52), R59 (= R54)
- binding (2E)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: G87 (= G82), Q88 (≠ M83), Y112 (= Y107), N160 (= N154), D185 (= D179), S206 (= S201), T208 (= T203), K209 (= K204), N369 (= N371), I370 (= I372), R404 (= R406)
7kb1A Complex of o-acety-l-homoserine aminocarboxypropyltransferase (mety) from thermotoga maritima and a key reaction intermediate (see paper)
57% identity, 98% coverage: 7:428/430 of query aligns to 11:426/428 of 7kb1A
- binding (2E)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: Y57 (= Y52), R59 (= R54), G87 (= G82), Q88 (≠ M83), Y112 (= Y107), N160 (= N154), D185 (= D179), S206 (= S201), T208 (= T203), K209 (= K204), N369 (= N371), I370 (= I372), R404 (= R406)
2ctzA Crystal structure of o-acetyl homoserine sulfhydrylase from thermus thermophilus hb8
52% identity, 99% coverage: 1:425/430 of query aligns to 1:420/421 of 2ctzA
- active site: R54 (= R54), Y107 (= Y107), D180 (= D179), K206 (= K204)
- binding pyridoxal-5'-phosphate: S81 (= S81), G82 (= G82), H83 (≠ M83), Q86 (≠ I86), Y107 (= Y107), D180 (= D179), T182 (= T181), S203 (= S201), T205 (= T203), K206 (= K204)
Q5SK88 O-acetyl-L-homoserine sulfhydrylase 1; OAH-sulfhydrylase 1; EC 2.5.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
52% identity, 99% coverage: 1:425/430 of query aligns to 1:420/421 of Q5SK88
- K206 (= K204) modified: N6-(pyridoxal phosphate)lysine
O13326 Homocysteine synthase; O-acetylhomoserine sulfhydrylase; OAH SHL; OAH sulfhydrylase; EC 2.5.1.49 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
54% identity, 99% coverage: 3:428/430 of query aligns to 8:429/429 of O13326
- G411 (= G410) mutation to D: Impairs homocysteine synthase activity.
8erbK Crystal structure of fub7 in complex with vinylglycine ketimine (see paper)
51% identity, 100% coverage: 1:428/430 of query aligns to 4:427/429 of 8erbK
- binding (2E)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: Y55 (= Y52), R57 (= R54), G85 (= G82), Q86 (≠ M83), Q89 (≠ I86), Y110 (= Y107), N157 (= N154), D182 (= D179), S205 (= S201), T207 (= T203), K208 (= K204), T385 (= T386), R405 (= R406)
8erjB Crystal structure of fub7 in complex with e-2-aminocrotonate (see paper)
51% identity, 100% coverage: 1:428/430 of query aligns to 3:426/428 of 8erjB
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]but-3-enoic acid: G84 (= G82), Q85 (≠ M83), Q88 (≠ I86), Y109 (= Y107), D181 (= D179), S204 (= S201), K207 (= K204), A368 (≠ V370), N369 (= N371), T384 (= T386), R404 (= R406)
8erjA Crystal structure of fub7 in complex with e-2-aminocrotonate (see paper)
51% identity, 100% coverage: 1:428/430 of query aligns to 3:426/428 of 8erjA
- binding (2E)-2-{[(1E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}but-2-enoic acid: S83 (= S81), G84 (= G82), Q85 (≠ M83), Q88 (≠ I86), Y109 (= Y107), N156 (= N154), D181 (= D179), S204 (= S201), T206 (= T203), K207 (= K204), R404 (= R406)
8wkoA Crystal structure of o-acetylhomoserine sulfhydrylase from lactobacillus plantarum in the closed form
49% identity, 99% coverage: 3:427/430 of query aligns to 9:424/425 of 8wkoA
- binding (2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid: G87 (= G82), S88 (≠ M83), Y112 (= Y107), E155 (= E150), D184 (= D179), T186 (= T181), S206 (= S201), A207 (≠ L202), T208 (= T203), F209 (≠ Y205), G212 (= G208), M217 (≠ I213), V369 (≠ I372), A370 (≠ G373)
- binding proline: H213 (= H209), Q284 (= Q282), S288 (≠ T286)
8ovhA Crystal structure of o-acetyl-l-homoserine sulfhydrolase from saccharomyces cerevisiae in complex with pyridoxal-5'-phosphate (see paper)
46% identity, 100% coverage: 3:430/430 of query aligns to 5:396/400 of 8ovhA
5x30C Crystal structure of pseudomonas putida methionine gamma-lyase c116h mutant with l-homocysteine intermediates. (see paper)
41% identity, 98% coverage: 7:426/430 of query aligns to 9:390/393 of 5x30C
3vk3A Crystal structure of l-methionine gamma-lyase from pseudomonas putida c116h mutant complexed with l-methionine (see paper)
41% identity, 98% coverage: 7:426/430 of query aligns to 13:394/397 of 3vk3A
5x2xA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-homocysteine intermediates (see paper)
41% identity, 98% coverage: 7:426/430 of query aligns to 8:389/392 of 5x2xA
- active site: R55 (= R54), Y108 (= Y107), D180 (= D179), K205 (= K204)
- binding (2E)-2-{[(1E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}but-2-enoic acid: Y53 (= Y52), R55 (= R54), G83 (= G82), M84 (= M83), Y108 (= Y107), N155 (= N154), D180 (= D179), S202 (= S201), T204 (= T203), K205 (= K204), V333 (= V370), S334 (≠ N371), R369 (= R406)
5x2wA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-methionine intermediates (see paper)
41% identity, 98% coverage: 7:426/430 of query aligns to 8:389/392 of 5x2wA
- active site: R55 (= R54), Y108 (= Y107), D180 (= D179), K205 (= K204)
- binding (2E)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]-4-(methylsulfanyl)but-2-enoic acid: Y53 (= Y52), R55 (= R54), S82 (= S81), G83 (= G82), M84 (= M83), Y108 (= Y107), D180 (= D179), S202 (= S201), K205 (= K204), V333 (= V370), S334 (≠ N371), R369 (= R406)
1pg8A Crystal structure of l-methionine alpha-, gamma-lyase
41% identity, 98% coverage: 7:426/430 of query aligns to 14:395/398 of 1pg8A
- active site: R61 (= R54), Y114 (= Y107), D186 (= D179), K211 (= K204)
- binding pyridoxal-5'-phosphate: Y59 (= Y52), R61 (= R54), S88 (= S81), G89 (= G82), M90 (= M83), Y114 (= Y107), D186 (= D179), S208 (= S201), T210 (= T203), K211 (= K204)
P13254 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-methioninase; EC 4.4.1.11; EC 4.4.1.2 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
41% identity, 98% coverage: 7:426/430 of query aligns to 14:395/398 of P13254
- YSR 59:61 (≠ YTR 52:54) binding
- R61 (= R54) mutation R->A,E,F: Loss of elimination activity against L-methionine.
- GM 89:90 (= GM 82:83) binding in other chain
- Y114 (= Y107) binding
- C116 (≠ G109) mutation to H: Drastic decrease of the catalytic efficiency of the elimination reaction with L-methionine, by 6700-fold, and increases that with L-cysteine by 7-fold, mainly due to changes in kcat. Loss of ability to catalyze replacement reaction between L-methionine and 2-mercaptoethanol.; mutation to S: 9% of wild-type elimination activity against L-methionine.; mutation to T: 40% of wild-type elimination activity against L-methionine.
- SAT 208:210 (≠ SLT 201:203) binding in other chain
- K211 (= K204) modified: N6-(pyridoxal phosphate)lysine
- K240 (≠ R266) mutation K->D,E: Marked decrease in elimination activity against both L-methionine and DL-homocysteine.; mutation to M: 50% reduction in alpha,gamma-elimination activity against DL-homocysteine, while retaining elimination activity against L-methionine and L-cysteine.
- D241 (≠ N267) mutation D->H,R: 5 to 14-fold reduction in alpha,gamma-elimination activity against L-methionine, while no change in affinity for L-methionine.
- R375 (= R406) binding
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
40% identity, 98% coverage: 8:428/430 of query aligns to 13:395/396 of 4hf8A
- active site: R59 (= R54), Y112 (= Y107), D184 (= D179), K209 (= K204)
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: G87 (= G82), I88 (≠ M83), Y112 (= Y107), E155 (= E150), N159 (= N154), D184 (= D179), S206 (= S201), K209 (= K204), S338 (≠ N371), R373 (= R406)
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
39% identity, 98% coverage: 8:428/430 of query aligns to 12:394/395 of 5m3zA
- active site: R58 (= R54), Y111 (= Y107), D183 (= D179), K208 (= K204)
- binding norleucine: Y111 (= Y107), H113 (≠ G109), K208 (= K204), V336 (= V370), S337 (≠ N371)
- binding pyridoxal-5'-phosphate: G86 (= G82), I87 (≠ M83), Y111 (= Y107), E154 (= E150), D183 (= D179), T185 (= T181), S205 (= S201), T207 (= T203), K208 (= K204)
- binding 2-[o-phosphonopyridoxyl]-amino-hexanoic acid: G86 (= G82), I87 (≠ M83), Y111 (= Y107), D183 (= D179), S205 (= S201), T207 (= T203), K208 (= K204), V336 (= V370), S337 (≠ N371), R372 (= R406)
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
39% identity, 98% coverage: 8:428/430 of query aligns to 13:395/396 of 4omaA
- active site: R59 (= R54), Y112 (= Y107), D184 (= D179), K209 (= K204)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: G87 (= G82), I88 (≠ M83), Y112 (= Y107), D184 (= D179), S206 (= S201), T208 (= T203), K209 (= K204), V337 (= V370), S338 (≠ N371), R373 (= R406)
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
39% identity, 98% coverage: 8:428/430 of query aligns to 13:395/396 of 3jwbA
Query Sequence
>7023700 FitnessBrowser__ANA3:7023700
MKLESLALHHGYESEATTKAAAVPIYQTTSYTFDDTQHGADLFDLKVAGNIYTRIMNPTS
SVLEQRLAAIEGGIGALALASGMAAITYAIQALTQVGDNIVSTSQLYGGTYNLFAHTLPR
QGVEVRMAAFDDFEELDALIDAKTKALFCESIGNPAGNIVDLKRLAEIAHKHGVPLIVDN
TVATPVLCRPFEHGADIVIHSLTKYIGGHGTTIGGVIIDSGKFDWVANKERFALLNQADP
SYHGVVYTEAFGAAAFIGRCRVVPLRNTGAALSPHSAFLLLQGLETLSLRMERHCSNALA
LAEYLILHPSVSWVNYGALPSSPYRENCQKITGGKASGIISFGIKAATPEEGKIAGGKFI
DALQMILRLVNIGDAKSLACHPASTTHRQLDANELARAGVSEDLIRISVGIEHIDDIIAD
VAQALEKALA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory