Comparing 7023724 FitnessBrowser__ANA3:7023724 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
64% identity, 97% coverage: 11:371/372 of query aligns to 7:366/367 of P0A7B5
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
63% identity, 97% coverage: 11:371/372 of query aligns to 5:364/365 of 2j5tD
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
56% identity, 97% coverage: 11:370/372 of query aligns to 5:323/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
56% identity, 97% coverage: 11:370/372 of query aligns to 5:321/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
37% identity, 64% coverage: 9:247/372 of query aligns to 1:226/241 of 2akoA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
36% identity, 69% coverage: 4:260/372 of query aligns to 7:257/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
34% identity, 69% coverage: 4:260/372 of query aligns to 7:235/236 of 7f5xA
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
29% identity, 30% coverage: 153:263/372 of query aligns to 120:215/225 of Q8U122
Sites not aligning to the query:
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
29% identity, 30% coverage: 153:263/372 of query aligns to 121:216/226 of 2bmuB
Sites not aligning to the query:
>7023724 FitnessBrowser__ANA3:7023724
MNLSEIAYRRVVVKLGTSVLTSGSKQLDKAHMVELARQMAALMRSGVEVVLCTSGAIAAG
REHLQYPELPDTMANKQLLAAVGQSQLILAWAQLFSIYGLHVGQLLLTRADLHDRERYLN
ARDTLNALLANNIIPIINENDAVATNEIKVGDNDNLSARAALLCDADLLILLTDQKGLFD
ADPRTNPNAKLISQVEKIDDSLRLLAGGSVSGLGTGGMSTKLEAADIARRAGIEVVIASG
HHPDVIKKVVGKESVGTHFSAIENPLESRKQWILAGPAAQGSLVLDAGAVKAVTEKGRSL
LSKGIIGVKGEFERGATLQLVDQKGKIIARGITRYCGEALGLIAGKHSDEIESVLGYDYG
DAIVHRNDMVVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory