Comparing 7023725 FitnessBrowser__ANA3:7023725 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
36% identity, 96% coverage: 13:419/425 of query aligns to 5:406/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
36% identity, 96% coverage: 13:419/425 of query aligns to 5:406/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
33% identity, 95% coverage: 4:405/425 of query aligns to 1:395/412 of 4jbeB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
27% identity, 39% coverage: 119:283/425 of query aligns to 108:273/455 of 5j7iC
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
27% identity, 39% coverage: 119:283/425 of query aligns to 109:274/456 of 5j7iB
Sites not aligning to the query:
7bvpA Adhe spirosome in extended conformation (see paper)
24% identity, 64% coverage: 119:389/425 of query aligns to 103:406/869 of 7bvpA
Sites not aligning to the query:
6tqmA Escherichia coli adhe structure in its compact conformation (see paper)
24% identity, 64% coverage: 119:389/425 of query aligns to 103:406/869 of 6tqmA
Sites not aligning to the query:
P0A9Q7 Bifunctional aldehyde-alcohol dehydrogenase AdhE; Alcohol dehydrogenase E; EC 1.2.1.10; EC 1.1.1.1 from Escherichia coli (strain K12) (see 8 papers)
24% identity, 64% coverage: 119:389/425 of query aligns to 103:406/891 of P0A9Q7
Sites not aligning to the query:
P0A9Q8 Bifunctional aldehyde-alcohol dehydrogenase AdhE; Alcohol dehydrogenase E; EC 1.2.1.10; EC 1.1.1.1 from Escherichia coli O157:H7 (see paper)
24% identity, 64% coverage: 119:389/425 of query aligns to 103:406/891 of P0A9Q8
Sites not aligning to the query:
4l1oB Crystal structure of human aldh3a1 with inhibitor 1-{[4-(1,3- benzodioxol-5-ylmethyl)piperazin-1-yl]methyl}-1h-indole-2,3-dione
29% identity, 40% coverage: 119:288/425 of query aligns to 103:270/452 of 4l1oB
Sites not aligning to the query:
4l2oA Crystal structure of human aldh3a1 with its selective inhibitor 1-(4- fluorophenyl)sulfonyl-2-methylbenzimidazole
29% identity, 40% coverage: 119:288/425 of query aligns to 103:270/446 of 4l2oA
Sites not aligning to the query:
4h80A Crystal structure of human aldh3a1 with its isozyme selective inhibitor - n-[4-(4-methylsulfonyl-2-nitroanilino)phenyl]acetamide
29% identity, 40% coverage: 119:288/425 of query aligns to 103:270/446 of 4h80A
Sites not aligning to the query:
3szbA Crystal structure of human aldh3a1 modified with the beta-elimination product of aldi-1; 1-phenyl- 2-propen-1-one (see paper)
29% identity, 40% coverage: 119:288/425 of query aligns to 103:270/447 of 3szbA
Sites not aligning to the query:
>7023725 FitnessBrowser__ANA3:7023725
MSQTNQAQYLQQLGSQAKQASYALANLSAVQKADLLEAIAEALTQNTQAILAANAKDVAA
AKAEGLNDAMIDRLLLNESRLAGIIGDIGDVVRLADPVGEEFGSRVLDNGLRLTRRRVPL
GVIGVIYEARPNVTVDIAVLALKTGNAVILRGGKETLESNKLISEVIRGAIASQGLPVDA
VQLIDSPDRALVTGLLKLDQYVDMIVPRGGQALQRLCAEQATIPVILGGIGICHLYVDKH
ADLERALEVIANAKVQRPTVCNALDTLLVDTAVAERFVPQIAEYLHRLGVRFSVCEQSYA
LLDGLGFDISPATEQSFATEWLSLTLGIKVVSDIDTAIAHIRTYSSGHSEAILTDDIHVA
THFMNEVNSAAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGLEALTTYKWLAWGD
YTSRA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory