SitesBLAST
Comparing 7023824 FitnessBrowser__ANA3:7023824 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3occF Crystal structure of pnp with dadmeimmh from yersinia pseudotuberculosis
72% identity, 99% coverage: 2:234/236 of query aligns to 1:233/238 of 3occF
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding 7-[[(3R,4R)-3-(hydroxymethyl)-4-oxidanyl-pyrrolidin-1-ium-1-yl]methyl]-3,5-dihydropyrrolo[3,2-d]pyrimidin-4-one: H4 (= H5), R43 (= R44), M64 (= M65), S90 (≠ T91), C91 (= C92), F159 (= F160), V178 (= V179), E179 (= E180), M180 (= M181), E181 (= E182), D204 (= D205), I206 (= I207)
1vhwA Crystal structure of purine nucleoside phosphorylase with adenosine (see paper)
71% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 1vhwA
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding adenosine: H4 (= H5), R43 (= R44), M64 (= M65), R87 (= R88), S90 (≠ T91), C91 (= C92), F159 (= F160), V178 (= V179), M180 (= M181), E181 (= E182)
3of3A Crystal structure of pnp with an inhibitor dadme_immh from vibrio cholerae
70% identity, 99% coverage: 2:234/236 of query aligns to 1:233/240 of 3of3A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding 7-[[(3R,4R)-3-(hydroxymethyl)-4-oxidanyl-pyrrolidin-1-ium-1-yl]methyl]-3,5-dihydropyrrolo[3,2-d]pyrimidin-4-one: M64 (= M65), S90 (≠ T91), C91 (= C92), F159 (= F160), V178 (= V179), E179 (= E180), M180 (= M181), E181 (= E182), D204 (= D205)
P0ABP8 Purine nucleoside phosphorylase DeoD-type; PNP; EC 2.4.2.1 from Escherichia coli (strain K12) (see 5 papers)
69% identity, 99% coverage: 1:234/236 of query aligns to 1:234/239 of P0ABP8
- M1 (= M1) modified: Initiator methionine, Removed
- G21 (= G21) binding in other chain
- R25 (= R25) binding in other chain; mutation to A: Severe loss of catalytic activity. 20-fold decrease in affinity for phosphate.
- K27 (= K27) modified: N6-acetyllysine
- R44 (= R44) binding
- RVGS 88:91 (≠ RVGT 88:91) binding in other chain
- D205 (= D205) active site, Proton donor; mutation D->A,N: Severe loss of catalytic activity.
- R218 (= R218) Important for catalytic activity; mutation to A: Severe loss of catalytic activity.
P0ABP9 Purine nucleoside phosphorylase DeoD-type; PNP; EC 2.4.2.1 from Escherichia coli O157:H7 (see paper)
69% identity, 99% coverage: 1:234/236 of query aligns to 1:234/239 of P0ABP9
- H5 (= H5) binding
- G21 (= G21) binding in other chain
- R25 (= R25) binding in other chain
- R44 (= R44) binding
- RVGS 88:91 (≠ RVGT 88:91) binding in other chain
- EME 180:182 (= EME 180:182) binding in other chain
- SD 204:205 (= SD 204:205) binding in other chain
5iu6A Crystal structure of e.Coli purine nucleoside phosphorylase with 7- deazahypoxanthine (see paper)
69% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 5iu6A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding 7H-pyrrolo[2,3-d]pyrimidin-4-ol: C91 (= C92), G92 (= G93), F159 (= F160), V178 (= V179), E179 (= E180)
5i3cA Crystal structure of e.Coli purine nucleoside phosphorylase with acycloguanosine (see paper)
69% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 5i3cA
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding 9-hyroxyethoxymethylguanine: S90 (≠ T91), C91 (= C92), G92 (= G93), F159 (= F160), V178 (= V179), E179 (= E180), I206 (= I207)
- binding sulfate ion: G20 (= G21), R87 (= R88), G89 (= G90), S90 (≠ T91)
3ut6A Crystal structure of e. Coli pnp complexed with po4 and formycin a (see paper)
69% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 3ut6A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding (1S)-1-(7-amino-1H-pyrazolo[4,3-d]pyrimidin-3-yl)-1,4-anhydro-D-ribitol: M64 (= M65), S90 (≠ T91), C91 (= C92), G92 (= G93), F159 (= F160), V178 (= V179), E179 (= E180), M180 (= M181), E181 (= E182), D204 (= D205)
- binding phosphate ion: G20 (= G21), R24 (= R25), R87 (= R88), G89 (= G90), S90 (≠ T91)
1pw7A Crystal structure of e. Coli purine nucleoside phosphorylase complexed with 9-beta-d-arabinofuranosyladenine and sulfate/phosphate (see paper)
69% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 1pw7A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding phosphate ion: G20 (= G21), R87 (= R88), S90 (≠ T91)
- binding 2-(6-amino-purin-9-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol: S90 (≠ T91), C91 (= C92), F159 (= F160), E179 (= E180), E181 (= E182), S203 (= S204)
1pr0A Escherichia coli purine nucleoside phosphorylase complexed with inosine and phosphate/sulfate (see paper)
69% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 1pr0A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding inosine: R87 (= R88), S90 (≠ T91), C91 (= C92), F159 (= F160), V178 (= V179), E179 (= E180), M180 (= M181), E181 (= E182), D204 (= D205)
- binding phosphate ion: G20 (= G21), R87 (= R88), G89 (= G90), S90 (≠ T91)
1pkeA Crystal structure of e. Coli purine nucleoside phosphorylase complexed with 2-fluoro-2'-deoxyadenosine and sulfate/phosphate (see paper)
69% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 1pkeA
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207)
- binding 5-(6-amino-2-fluoro-purin-9-yl)-2-hydroxymethyl-tetrahydro-furan-3-ol: S90 (≠ T91), C91 (= C92), F159 (= F160), V178 (= V179), E179 (= E180), M180 (= M181), E181 (= E182), D204 (= D205)
- binding phosphate ion: G20 (= G21), R87 (= R88), G89 (= G90), S90 (≠ T91)
1pk9A Crystal structure of e. Coli purine nucleoside phosphorylase complexed with 2-fluoroadenosine and sulfate/phosphate (see paper)
69% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 1pk9A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding 2-(6-amino-2-fluoro-purin-9-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol: M64 (= M65), S90 (≠ T91), C91 (= C92), F159 (= F160), V178 (= V179), E179 (= E180), M180 (= M181), E181 (= E182), D204 (= D205)
- binding phosphate ion: G20 (= G21), R87 (= R88), S90 (≠ T91)
1pk7A Crystal structure of e. Coli purine nucleoside phosphorylase complexed with adenosine and sulfate/phosphate (see paper)
69% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 1pk7A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding adenosine: M64 (= M65), S90 (≠ T91), C91 (= C92), F159 (= F160), M180 (= M181), E181 (= E182), D204 (= D205)
- binding phosphate ion: G20 (= G21), R87 (= R88)
1otyA Native pnp +allo (see paper)
69% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 1otyA
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding 6-methylpurine: G92 (= G93), F159 (= F160), V178 (= V179), M180 (= M181)
1k9sD Purine nucleoside phosphorylase from e. Coli in complex with formycin a derivative and phosphate (see paper)
69% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 1k9sD
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding 2-hydroxymethyl-5-(7-methylamino-3h-pyrazolo[4,3-d]pyrimidin-3-yl)-tetrahydro-furan-3,4-diol: M64 (= M65), S90 (≠ T91), C91 (= C92), G92 (= G93), F159 (= F160), V178 (= V179), E179 (= E180), M180 (= M181), E181 (= E182), D204 (= D205), I206 (= I207)
- binding 2-(7-amino-6-methyl-3h-pyrazolo[4,3-d]pyrimidin-3-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol: H4 (= H5), R43 (= R44)
- binding phosphate ion: G20 (= G21), R24 (= R25), R87 (= R88), G89 (= G90), S90 (≠ T91)
1k9sA Purine nucleoside phosphorylase from e. Coli in complex with formycin a derivative and phosphate (see paper)
69% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 1k9sA
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding 2-(7-amino-6-methyl-3h-pyrazolo[4,3-d]pyrimidin-3-yl)-5-hydroxymethyl-tetrahydro-furan-3,4-diol: M64 (= M65), S90 (≠ T91), C91 (= C92), G92 (= G93), F159 (= F160), V178 (= V179), E179 (= E180), M180 (= M181), E181 (= E182), S203 (= S204)
- binding phosphate ion: G20 (= G21), R24 (= R25), R87 (= R88), G89 (= G90), S90 (≠ T91)
1a69A Purine nucleoside phosphorylase in complex with formycin b and sulphate (phosphate) (see paper)
69% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 1a69A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding formycin b: M64 (= M65), S90 (≠ T91), C91 (= C92), G92 (= G93), F159 (= F160), V178 (= V179), E179 (= E180), M180 (= M181), E181 (= E182), D204 (= D205)
1ovgA M64v pnp +mepdr (see paper)
69% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 1ovgA
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding 9-(2-deoxy-beta-d-ribofuranosyl)-6-methylpurine: S90 (≠ T91), F159 (= F160), V178 (= V179)
1ov6A M64v pnp + allo (see paper)
69% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 1ov6A
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding 9-(6-deoxy-beta-d-allofuranosyl)-6-methylpurine: S90 (≠ T91), C91 (= C92), F159 (= F160), V178 (= V179), E179 (= E180), M180 (= M181), S203 (= S204)
1oumA M64v pnp +talo (see paper)
69% identity, 99% coverage: 2:234/236 of query aligns to 1:233/237 of 1oumA
- active site: H4 (= H5), G20 (= G21), R24 (= R25), R43 (= R44), E75 (= E76), R87 (= R88), S90 (≠ T91), S203 (= S204), D204 (= D205), I206 (= I207), R217 (= R218)
- binding 9-(6-deoxy-alpha-l-talofuranosyl)-6-methylpurine: D21 (= D22), S90 (≠ T91), C91 (= C92), F159 (= F160), V178 (= V179), M180 (= M181), E181 (= E182)
Query Sequence
>7023824 FitnessBrowser__ANA3:7023824
MATPHINAVEGAFAETVLFPGDPLRAKYIAETFLENVEQVTDVRNMLGFTGTYKGKRISV
MGSGMGIPSCSIYATELIKDYGVKNLIRVGTCGAISTDVKVRDVIIGMGACTDSQVNRLR
FKGQDFAAIANYELMNAVIESAKVKGTKIRVGNVFSADLFYTPDPQMFDVMEKMGVLGVE
MEAAGLYGVAHEFGARALCVVTVSDHIRTGEKTTSDERQTTFNDMIVMTLDAAITL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory