SitesBLAST
Comparing 7023826 FitnessBrowser__ANA3:7023826 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O53289 Phosphoserine phosphatase SerB2; PSP; PSPase; O-phosphoserine phosphohydrolase; Protein-serine/threonine phosphatase; EC 3.1.3.3; EC 3.1.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
47% identity, 62% coverage: 125:328/330 of query aligns to 181:384/409 of O53289
- D185 (= D129) mutation to G: Completely abolishes enzymatic activity.; mutation to N: Completely abolishes enzymatic activity.
- V186 (≠ M130) mutation to Q: Decreases enzymatic activity by 50%.
- D187 (= D131) mutation to N: Decreases enzymatic activity by 15%.
- S188 (= S132) mutation to A: No effect on enzymatic activity.
- S273 (= S217) mutation to A: Completely abolishes enzymatic activity (PubMed:25521849). Decreases enzymatic activity by 60% (PubMed:25037224).
- K318 (= K262) mutation to A: Decreases enzymatic activity by 50%.; mutation to E: Completely abolishes enzymatic activity.
- D341 (= D285) mutation to G: Decreases enzymatic activity by 80%.; mutation to N: Decreases enzymatic activity by 85%. Completely abolishes enzymatic activity, does not elicit cytoskeletal rearrangements, and does not suppress IL-8 production after TNF-alpha stimulation; when associated with N-345.
- D345 (= D289) mutation to N: Decreases enzymatic activity by 55%. Completely abolishes enzymatic activity, does not elicit cytoskeletal rearrangements, and does not suppress IL-8 production after TNF-alpha stimulation; when associated with N-341.
Sites not aligning to the query:
- 18 G→A: Does not bind L-serine and correspondingly no oligomeric transitions is observed in the presence of L-serine.
- 108 G→A: Does not bind L-serine and correspondingly no oligomeric transitions is observed in the presence of L-serine.
A0QJI1 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Mycobacterium avium (strain 104) (see paper)
48% identity, 62% coverage: 125:328/330 of query aligns to 183:386/411 of A0QJI1
- D187 (= D129) binding
- D189 (= D131) binding
- D343 (= D285) binding
5jlpA Crystal structure of mycobacterium avium serb2 in complex with serine at act domain
48% identity, 62% coverage: 125:328/330 of query aligns to 179:382/396 of 5jlpA
Sites not aligning to the query:
8a21A Crystal structure of phosphoserine phosphatase serb from mycobacterium avium in complex with phenylimidazole (see paper)
48% identity, 62% coverage: 125:328/330 of query aligns to 179:382/396 of 8a21A
- binding magnesium ion: D183 (= D129), D185 (= D131), D339 (= D285)
- binding 4-phenyl-1h-imidazole: D185 (= D131), E192 (= E138), V193 (≠ C139), I194 (= I140), T211 (= T157), M215 (= M161), F221 (= F167), R228 (= R174), G273 (= G219)
Sites not aligning to the query:
8a1zA Crystal structure of phosphoserine phosphatase serb from mycobacterium avium in complex with 1-(2,4-dichlorophenyl)-3-hydroxyurea (see paper)
48% identity, 62% coverage: 125:328/330 of query aligns to 179:382/396 of 8a1zA
- binding 1-(2,4-dichlorophenyl)-3-oxidanyl-urea: D185 (= D131), E192 (= E138), M215 (= M161), F221 (= F167), L225 (= L171), R228 (= R174), G272 (= G218), F274 (= F220), D339 (= D285)
- binding magnesium ion: D183 (= D129), D185 (= D131), D339 (= D285)
1f5sA Crystal structure of phosphoserine phosphatase from methanococcus jannaschii (see paper)
42% identity, 62% coverage: 125:327/330 of query aligns to 6:209/210 of 1f5sA
- active site: D10 (= D129), F11 (≠ M130), D12 (= D131), G99 (= G218), K143 (= K262), D170 (= D289)
- binding magnesium ion: D10 (= D129), D12 (= D131), D166 (= D285)
- binding phosphate ion: D10 (= D129), F11 (≠ M130), D12 (= D131), S98 (= S217), G99 (= G218), K143 (= K262)
1l7nA Transition state analogue of phosphoserine phosphatase (aluminum fluoride complex) (see paper)
42% identity, 62% coverage: 125:327/330 of query aligns to 5:208/209 of 1l7nA
- active site: D9 (= D129), F10 (≠ M130), D11 (= D131), G98 (= G218), K142 (= K262), D169 (= D289)
- binding aluminum fluoride: D9 (= D129), F10 (≠ M130), D11 (= D131), S97 (= S217), K142 (= K262)
- binding tetrafluoroaluminate ion: D9 (= D129), F10 (≠ M130), D11 (= D131), S97 (= S217), G98 (= G218), K142 (= K262), N168 (= N288)
- binding magnesium ion: D9 (= D129), D11 (= D131), D165 (= D285)
Q58989 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see 3 papers)
42% identity, 62% coverage: 125:327/330 of query aligns to 7:210/211 of Q58989
- D11 (= D129) active site, Nucleophile; binding ; mutation to N: Loss of activity.
- D13 (= D131) active site, Proton donor; binding
- E20 (= E138) binding
- R56 (= R174) binding
- SG 99:100 (= SG 217:218) binding
- K144 (= K262) binding
- D167 (= D285) binding
- N170 (= N288) binding
1l7pA Substrate bound phosphoserine phosphatase complex structure (see paper)
42% identity, 62% coverage: 125:327/330 of query aligns to 4:207/208 of 1l7pA
- active site: N8 (≠ D129), F9 (≠ M130), D10 (= D131), G97 (= G218), K141 (= K262), D168 (= D289)
- binding phosphoserine: N8 (≠ D129), F9 (≠ M130), D10 (= D131), E17 (= E138), M40 (= M161), F46 (= F167), R53 (= R174), S96 (= S217), G97 (= G218), K141 (= K262)
7qplA Crystal structure of phosphoserine phosphatase (serb) from brucella melitensis in complex with phosphate and magnesium
39% identity, 62% coverage: 125:330/330 of query aligns to 82:288/295 of 7qplA
1l7oA Crystal structure of phosphoserine phosphatase in apo form (see paper)
40% identity, 62% coverage: 125:327/330 of query aligns to 4:199/200 of 1l7oA
3m1yC Crystal structure of a phosphoserine phosphatase (serb) from helicobacter pylori
36% identity, 62% coverage: 125:329/330 of query aligns to 5:208/208 of 3m1yC
P78330 Phosphoserine phosphatase; PSP; PSPase; L-3-phosphoserine phosphatase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Homo sapiens (Human) (see 4 papers)
32% identity, 54% coverage: 126:302/330 of query aligns to 17:196/225 of P78330
- D20 (= D129) binding
- DVD 20:22 (≠ DMD 129:131) binding
- D22 (= D131) binding
- S23 (= S132) mutation to A: Reduces L-phosphoserine phosphatase activity by about 50%.; mutation to T: Reduces L-phosphoserine phosphatase activity by about 80%.
- E29 (= E138) mutation to D: Reduces L-phosphoserine phosphatase activity by about 95%.; mutation to Q: Loss of L-phosphoserine phosphatase activity.
- D32 (= D141) to N: in PSPHD; decreased L-phosphoserine phosphatase activity; dbSNP:rs104894035
- A35 (= A144) to T: in PSPHD; decreased L-phosphoserine phosphatase activity
- M52 (= M161) binding ; to T: in PSPHD; decreased L-phosphoserine phosphatase activity; dbSNP:rs104894036
- G53 (≠ Q162) binding
- R65 (= R174) mutation R->A,K: Loss of L-phosphoserine phosphatase activity.
- SGG 109:111 (= SGG 217:219) binding ; binding
- N133 (= N239) mutation to A: Reduces L-phosphoserine phosphatase activity by about 75%.
- K158 (= K262) binding ; binding
- D179 (= D285) binding
- T182 (≠ N288) binding ; binding ; mutation to S: Reduces L-phosphoserine phosphatase activity by about 99%.; mutation to V: Reduces L-phosphoserine phosphatase activity by about 25%.
Sites not aligning to the query:
- 202 R→A: Reduces L-phosphoserine phosphatase activity by about 99%.; R→K: Reduces L-phosphoserine phosphatase activity by about 95%.
6hyjB Psph human phosphoserine phosphatase (see paper)
32% identity, 54% coverage: 126:302/330 of query aligns to 17:196/223 of 6hyjB
Sites not aligning to the query:
6hyyA Human phosphoserine phosphatase with serine and phosphate (see paper)
32% identity, 54% coverage: 126:302/330 of query aligns to 13:192/221 of 6hyyA
1l8oA Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase (see paper)
32% identity, 54% coverage: 126:302/330 of query aligns to 14:193/222 of 1l8oA
Sites not aligning to the query:
1l8lA Molecular basis for the local confomational rearrangement of human phosphoserine phosphatase (see paper)
32% identity, 54% coverage: 126:302/330 of query aligns to 14:193/222 of 1l8lA
- active site: D17 (= D129), V18 (≠ M130), D19 (= D131), G107 (= G218), K155 (= K262), D180 (= D289)
- binding d-2-amino-3-phosphono-propionic acid: D17 (= D129), D19 (= D131), G107 (= G218), K155 (= K262), D176 (= D285), G177 (= G286), T179 (≠ N288)
6q6jB Human phosphoserine phosphatase with substrate analogue homo-cysteic acid (see paper)
32% identity, 54% coverage: 126:302/330 of query aligns to 13:192/217 of 6q6jB
- binding calcium ion: D16 (= D129), D18 (= D131), D175 (= D285)
- binding (2~{S})-2-azanyl-4-sulfo-butanoic acid: D16 (= D129), V17 (≠ M130), D18 (= D131), F54 (= F167), S105 (= S217), G106 (= G218), G107 (= G219), K154 (= K262), T178 (≠ N288)
6iuyA Structure of dsgpdh of dunaliella salina (see paper)
25% identity, 59% coverage: 126:320/330 of query aligns to 17:217/585 of 6iuyA
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 233, 234, 235, 236, 268, 290, 321, 324, 349, 381, 382, 497, 529, 530, 532
4ap9A Crystal structure of phosphoserine phosphatase from t.Onnurineus in complex with ndsb-201 (see paper)
27% identity, 53% coverage: 127:301/330 of query aligns to 13:174/200 of 4ap9A
- active site: D15 (= D129), I16 (≠ M130), E17 (≠ D131), G103 (= G218), K141 (= K262), D162 (= D289)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: R31 (≠ A145), I32 (≠ M146), T33 (≠ A147), L46 (≠ M161), W52 (≠ F167), D140 (vs. gap), K141 (= K262), Y160 (≠ A287), A161 (≠ N288)
Query Sequence
>7023826 FitnessBrowser__ANA3:7023826
MESLNQNALFVWLAASPSPRFEYQGLSFETYQESSTRPSQSGFAMRLIYEDLSIEDSLAA
WIVSLAKSLKLTSLSIAPIRRQVALHCVELALPVEPSAELLATCPSLVELHLIRGPLPKL
SEPGLLVMDMDSTAIQIECIDELAAMAGVGEQVAAITERAMQGELDFEQSLRQRVAQLQG
ADAKIIQTLCDTLPLMPGLEAMLTELKSHHWRLVVASGGFTPFVGHLKQLLNLDAAFANE
LVIADGKLAGTVTGKVVDAQFKAYVVNRCSQDWQIPAGQRVAIGDGANDIPMVQAADFGI
AFHAKPKLAAAADARIRSLDLRVLPYLLQF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory