Comparing 7024234 FitnessBrowser__ANA3:7024234 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2nwwA Crystal structure of gltph in complex with tboa (see paper)
26% identity, 93% coverage: 16:395/408 of query aligns to 11:401/407 of 2nwwA
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
26% identity, 96% coverage: 4:395/408 of query aligns to 9:410/425 of O59010
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
26% identity, 96% coverage: 4:395/408 of query aligns to 6:407/413 of 6x14A
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
26% identity, 96% coverage: 4:395/408 of query aligns to 1:402/409 of 6bavA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
26% identity, 96% coverage: 4:395/408 of query aligns to 9:410/419 of 6x15A
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
26% identity, 96% coverage: 4:395/408 of query aligns to 1:402/408 of 6bauA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
27% identity, 95% coverage: 16:404/408 of query aligns to 11:412/416 of 6r7rA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
26% identity, 98% coverage: 4:404/408 of query aligns to 7:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
26% identity, 98% coverage: 4:404/408 of query aligns to 7:423/427 of 5e9sA
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
26% identity, 98% coverage: 4:404/408 of query aligns to 5:421/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
26% identity, 98% coverage: 4:404/408 of query aligns to 4:420/424 of 6zl4A
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
27% identity, 77% coverage: 4:317/408 of query aligns to 1:322/396 of 6bmiA
Sites not aligning to the query:
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
28% identity, 59% coverage: 146:386/408 of query aligns to 204:445/503 of Q10901
Sites not aligning to the query:
7bcsA Asct2 in the presence of the inhibitor lc-bpe (position "down") in the outward-open conformation. (see paper)
28% identity, 63% coverage: 135:392/408 of query aligns to 172:431/442 of 7bcsA
7bcqA Asct2 in the presence of the inhibitor lc-bpe (position "up") in the outward-open conformation. (see paper)
28% identity, 63% coverage: 135:392/408 of query aligns to 172:431/442 of 7bcqA
Sites not aligning to the query:
6mpbB Cryo-em structure of the human neutral amino acid transporter asct2 (see paper)
28% identity, 63% coverage: 138:392/408 of query aligns to 179:435/446 of 6mpbB
Q15758 Neutral amino acid transporter B(0); ATB(0); Baboon M7 virus receptor; RD114/simian type D retrovirus receptor; Sodium-dependent neutral amino acid transporter type 2; Solute carrier family 1 member 5 from Homo sapiens (Human) (see 2 papers)
28% identity, 63% coverage: 138:392/408 of query aligns to 221:477/541 of Q15758
Sites not aligning to the query:
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
24% identity, 68% coverage: 103:378/408 of query aligns to 177:479/542 of P43003
Sites not aligning to the query:
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
24% identity, 90% coverage: 23:390/408 of query aligns to 33:391/412 of 7awmA
7nsgA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with hip-b
24% identity, 71% coverage: 103:390/408 of query aligns to 127:409/430 of 7nsgA
Sites not aligning to the query:
>7024234 FitnessBrowser__ANA3:7024234
MKQESSLLAKLANGSLVLQILVGIIAGVSLASFSHEAAKQVAFLGSLFVGALKAIAPILV
FILVASSIANQKKNTQTNMRPIVVLYLFGTFAAALTAVVLSMMFPTNLVLVAGVEGTSPP
QGIGEVINTLLFKLVDNPVNALMTGNYIGILAWGVGLGLALHHASDSTKQVFADVSHGIS
QMVRFIIRLAPIGIFGLVAATFAETGFAAIAGYAKLLAVLLGAMAIIALIVNPLIVYVKI
KRNPYPLVIRCLRESGVTAFFTRSSAANIPVNMALCEKLKLHEDTYSVSIPLGATINMGG
AAITITVLTLAAAHTLGIQVDLLTALLLSVVAAISACGASGVAGGSLLLIPLACSLFGIS
NDVAMQVVAVGFIIGVIQDAAETALNSSTDVIFTAAACEAAENKAKLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory