SitesBLAST
Comparing 7024324 FitnessBrowser__ANA3:7024324 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5kzmB Crystal structure of tryptophan synthase alpha-beta chain complex from francisella tularensis (see paper)
84% identity, 99% coverage: 5:396/396 of query aligns to 3:395/395 of 5kzmB
4kkxB Crystal structure of tryptophan synthase from salmonella typhimurium with 2-aminophenol quinonoid in the beta site and the f6 inhibitor in the alpha site (see paper)
80% identity, 99% coverage: 6:396/396 of query aligns to 4:395/395 of 4kkxB
- active site: K86 (= K88), E108 (= E110), S376 (= S377)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-3-[(2-hydroxyphenyl)amino]-D-alanine: H85 (= H87), K86 (= K88), E108 (= E110), T109 (= T111), G110 (= G112), A111 (= A113), Q113 (= Q115), H114 (= H116), L165 (= L167), T189 (= T191), G231 (= G233), G232 (= G234), G233 (= G235), S234 (= S236), N235 (= N237), G302 (= G304), F305 (= F307), E349 (= E351), S376 (= S377), G377 (= G378)
4hpxB Crystal structure of tryptophan synthase at 1.65 a resolution in complex with alpha aminoacrylate e(a-a) and benzimidazole in the beta site and the f9 inhibitor in the alpha site (see paper)
80% identity, 99% coverage: 6:396/396 of query aligns to 4:395/395 of 4hpxB
- active site: K86 (= K88), E108 (= E110), S376 (= S377)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H85 (= H87), K86 (= K88), T109 (= T111), G110 (= G112), A111 (= A113), G112 (= G114), Q113 (= Q115), H114 (= H116), T189 (= T191), G231 (= G233), G232 (= G234), G233 (= G235), S234 (= S236), N235 (= N237), G302 (= G304), E349 (= E351), S376 (= S377), G377 (= G378)
- binding benzimidazole: L4 (= L6), N5 (= N7), K86 (= K88), E108 (= E110), A135 (= A137), K136 (= K138), L165 (= L167), G188 (= G190), T189 (= T191), G231 (= G233), G232 (= G234), F305 (= F307)
Sites not aligning to the query:
4hpjB Crystal structure of tryptophan synthase at 1.45 a resolution in complex with 2-aminophenol quinonoid in the beta site and the f9 inhibitor in the alpha site (see paper)
80% identity, 99% coverage: 6:396/396 of query aligns to 4:395/395 of 4hpjB
- active site: K86 (= K88), E108 (= E110), S376 (= S377)
- binding (2E)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]-3-[(2-hydroxyphenyl)amino]propanoic acid: H85 (= H87), K86 (= K88), E108 (= E110), T109 (= T111), G110 (= G112), A111 (= A113), Q113 (= Q115), H114 (= H116), L165 (= L167), T189 (= T191), G231 (= G233), G232 (= G234), G233 (= G235), S234 (= S236), N235 (= N237), G302 (= G304), E349 (= E351), S376 (= S377), G377 (= G378)
4hn4B Tryptophan synthase in complex with alpha aminoacrylate e(a-a) form and the f9 inhibitor in the alpha site (see paper)
80% identity, 99% coverage: 6:396/396 of query aligns to 4:395/395 of 4hn4B
- active site: K86 (= K88), E108 (= E110), S376 (= S377)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H85 (= H87), K86 (= K88), T109 (= T111), G110 (= G112), A111 (= A113), Q113 (= Q115), H114 (= H116), T189 (= T191), G231 (= G233), G233 (= G235), S234 (= S236), N235 (= N237), G302 (= G304), E349 (= E351), S376 (= S377), G377 (= G378)
6xt0B Salmonella typhimurium tryptophan synthase complexed with dioxindolyl- l-alanine and d-glycerol-3-phosphate (see paper)
80% identity, 99% coverage: 6:396/396 of query aligns to 4:395/396 of 6xt0B
- active site: K86 (= K88), E108 (= E110), S376 (= S377)
- binding sodium ion: G231 (= G233), P269 (= P271), F305 (= F307), S307 (= S309)
- binding 4-[(E)-({1-carboxy-2-[(3R)-3-hydroxy-2-oxo-2,3-dihydro-1H-indol-3-yl]ethan-1-id-1-yl}iminio)methyl]-2-methyl-5-[(phosphonooxy)methyl]pyridin-1-ium-3-olate: H85 (= H87), K86 (= K88), E108 (= E110), T109 (= T111), G110 (= G112), Q113 (= Q115), H114 (= H116), L165 (= L167), G188 (= G190), T189 (= T191), G231 (= G233), G232 (= G234), G233 (= G235), S234 (= S236), N235 (= N237), G302 (= G304), F305 (= F307), E349 (= E351), S376 (= S377)
- binding 4-[(E)-({1-carboxy-2-[(3R)-3-hydroxy-2-oxo-2,3-dihydro-1H-indol-3-yl]ethan-1-id-1-yl}iminio)methyl]-2-methyl-5-[(phosphonooxy)methyl]pyridin-1-ium-3-olate: H85 (= H87), K86 (= K88), E108 (= E110), T109 (= T111), G110 (= G112), Q113 (= Q115), H114 (= H116), L165 (= L167), T189 (= T191), G231 (= G233), G232 (= G234), G233 (= G235), S234 (= S236), N235 (= N237), G302 (= G304), F305 (= F307), E349 (= E351), S376 (= S377), G377 (= G378)
6xrhB Salmonella typhimurium tryptophan synthase complexed with oxindolyl-l- alanine and d-glycerol-3-phosphate (see paper)
80% identity, 99% coverage: 6:396/396 of query aligns to 4:395/396 of 6xrhB
- active site: K86 (= K88), E108 (= E110), S376 (= S377)
- binding sodium ion: G231 (= G233), P269 (= P271), F305 (= F307), S307 (= S309)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-3-[(3S)-2-oxo-2,3-dihydro-1H-indol-3-yl]-L-alanine: H85 (= H87), K86 (= K88), T109 (= T111), G110 (= G112), A111 (= A113), Q113 (= Q115), H114 (= H116), L165 (= L167), G188 (= G190), T189 (= T191), V230 (= V232), G231 (= G233), G232 (= G234), G233 (= G235), S234 (= S236), N235 (= N237), G302 (= G304), F305 (= F307), E349 (= E351), S376 (= S377)
- binding 4-[(E)-({1-carboxy-2-[(3S)-2-oxo-2,3-dihydro-1H-indol-3-yl]ethan-1-id-1-yl}iminio)methyl]-2-methyl-5-[(phosphonooxy)methyl]pyridin-1-ium-3-olate: H85 (= H87), K86 (= K88), E108 (= E110), T109 (= T111), G110 (= G112), Q113 (= Q115), H114 (= H116), L165 (= L167), T189 (= T191), G231 (= G233), G232 (= G234), G233 (= G235), S234 (= S236), N235 (= N237), G302 (= G304), F305 (= F307), E349 (= E351), S376 (= S377)
6xoyB Salmonella typhimurium tryptophan synthase complexed with d-tryptophan and d-glycerol-3-phosphate (see paper)
80% identity, 99% coverage: 6:396/396 of query aligns to 4:395/396 of 6xoyB
- active site: K86 (= K88), E108 (= E110), S376 (= S377)
- binding sodium ion: G231 (= G233), P269 (= P271), F305 (= F307), S307 (= S309)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-D-tryptophan: H85 (= H87), K86 (= K88), E108 (= E110), T109 (= T111), G110 (= G112), A111 (= A113), Q113 (= Q115), H114 (= H116), L165 (= L167), T189 (= T191), G231 (= G233), G232 (= G234), G233 (= G235), S234 (= S236), N235 (= N237), G302 (= G304), F305 (= F307), E349 (= E351), S376 (= S377)
6xinB The crystal structure of tryptophan synthase from salmonella enterica serovar typhimurium in complex with (2s)-3-amino-3-imino-2- phenyldiazenylpropanamide at the enzyme alpha-site.
80% identity, 99% coverage: 6:396/396 of query aligns to 4:395/396 of 6xinB
- active site: K86 (= K88), E108 (= E110), S376 (= S377)
- binding pyridoxal-5'-phosphate: H85 (= H87), K86 (= K88), T189 (= T191), G231 (= G233), G233 (= G235), S234 (= S236), N235 (= N237), E349 (= E351), S376 (= S377), G377 (= G378)
- binding (2R,3Z)-3-amino-3-imino-2-[(E)-phenyldiazenyl]propanamide: V16 (= V18), P17 (= P19), L20 (= L22), L173 (≠ M175), Y185 (= Y187), L187 (= L189), P193 (= P195), F279 (= F281)
7jqwB The external aldimine crystal structure of salmonella typhimurium tryptophan synthase mutant beta-s377a in complex with cesium ion at the metal coordination site. The single beta-q114 rotamer conformation allows a hydrogen bond to form with the plp oxygen at the position 3 in the ring
80% identity, 99% coverage: 6:396/396 of query aligns to 4:395/395 of 7jqwB
- binding 2-aminophenol: Q18 (= Q20), M21 (≠ V23), P22 (= P24), H81 (= H83), V116 (= V118)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: H85 (= H87), K86 (= K88), T109 (= T111), G110 (= G112), A111 (= A113), Q113 (= Q115), H114 (= H116), T189 (= T191), G231 (= G233), G233 (= G235), S234 (= S236), N235 (= N237), G302 (= G304), D304 (= D306), E349 (= E351)
- binding serine: K128 (= K130), R149 (= R151), G152 (= G154), A153 (= A155), E154 (= E156)
7lv5B The internal aldimine form of the wild-type salmonella typhimurium tryptophan synthase in complex with inhibitor n-(4'- trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9f) at the enzyme alpha-site, cesium ion at the metal coordination site and l-histidine at the enzyme beta-site at 1.55 angstrom resolution
81% identity, 98% coverage: 6:394/396 of query aligns to 4:393/393 of 7lv5B
- binding histidine: K86 (= K88), E108 (= E110), T109 (= T111), G110 (= G112), Q113 (= Q115), H114 (= H116), L165 (= L167)
- binding pyridoxal-5'-phosphate: H85 (= H87), K86 (= K88), T189 (= T191), G231 (= G233), G233 (= G235), S234 (= S236), N235 (= N237), E349 (= E351), S376 (= S377), G377 (= G378)
3cepB Structure of a tryptophan synthase quinonoid intermediate (see paper)
81% identity, 98% coverage: 6:394/396 of query aligns to 4:393/393 of 3cepB
- binding indoline: K86 (= K88), L165 (= L167), T189 (= T191), G232 (= G234), F305 (= F307)
- binding 3-hydroxy-2-iminopropanoic acid: K86 (= K88), T109 (= T111), G110 (= G112), A111 (= A113), G112 (= G114), Q113 (= Q115), H114 (= H116)
- binding pyridoxal-5'-phosphate: H85 (= H87), K86 (= K88), T189 (= T191), G231 (= G233), G232 (= G234), G233 (= G235), S234 (= S236), N235 (= N237), G302 (= G304), E349 (= E351), S376 (= S377), G377 (= G378)
7jmqB The external aldimine form of the mutant beta-s377a salmonella thypi tryptophan synthase in open conformation showing dual side chain conformations for the residue beta-q114, sodium ion at the metal coordination site, and f9 inhibitor at the alpha-site. One of the beta-q114 rotamer conformations allows a hydrogen bond to form with the plp oxygen at the position 3 in the ring
80% identity, 99% coverage: 6:396/396 of query aligns to 4:395/396 of 7jmqB
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: H85 (= H87), K86 (= K88), T109 (= T111), G110 (= G112), A111 (= A113), Q113 (= Q115), H114 (= H116), T189 (= T191), G231 (= G233), G233 (= G235), S234 (= S236), N235 (= N237), G302 (= G304), D304 (= D306), E349 (= E351)
2clfB Tryptophan synthase in complex with n-(4'- trifluoromethoxybenzoyl)-2-amino-1-ethylphosphate (f6) - highf6 complex (see paper)
81% identity, 98% coverage: 6:394/396 of query aligns to 4:393/394 of 2clfB
- active site: K86 (= K88), E108 (= E110), S376 (= S377)
- binding 2-{[4-(trifluoromethoxy)benzoyl]amino}ethyl dihydrogen phosphate: P17 (= P19), E108 (= E110), T109 (= T111), G110 (= G112), H114 (= H116), L165 (= L167), C169 (= C171), L187 (= L189), G188 (= G190), T189 (= T191), F279 (= F281)
- binding pyridoxal-5'-phosphate: H85 (= H87), K86 (= K88), T189 (= T191), G231 (= G233), G232 (= G234), G233 (= G235), S234 (= S236), N235 (= N237), E349 (= E351), S376 (= S377), G377 (= G378)
Sites not aligning to the query:
8b05B Tryptophan synthase - cryo-trapping by the spitrobot crystal plunger after 20 sec (see paper)
81% identity, 98% coverage: 6:394/396 of query aligns to 4:393/394 of 8b05B
- binding indole: A213 (≠ K215), Q214 (= Q216)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H85 (= H87), K86 (= K88), T109 (= T111), G110 (= G112), Q113 (= Q115), H114 (= H116), T189 (= T191), G231 (= G233), G232 (= G234), G233 (= G235), S234 (= S236), N235 (= N237), G302 (= G304), D304 (= D306), E349 (= E351), S376 (= S377)
2j9xB Tryptophan synthase in complex with gp, alpha-d,l-glycerol- phosphate, cs, ph6.5 - alpha aminoacrylate form - (gp)e(a- a) (see paper)
81% identity, 98% coverage: 6:394/396 of query aligns to 4:393/394 of 2j9xB
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H85 (= H87), K86 (= K88), T109 (= T111), G110 (= G112), A111 (= A113), Q113 (= Q115), H114 (= H116), T189 (= T191), G231 (= G233), G233 (= G235), S234 (= S236), N235 (= N237), G302 (= G304), E349 (= E351), S376 (= S377), G377 (= G378)
6ducB Crystal structure of mutant beta-k167t tryptophan synthase in complex with inhibitor n-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1- ethylphosphate (f9f) at the alpha-site, cesium ion at the metal coordination site, and 2-aminophenol quinonoid (1d0) at the beta-site
80% identity, 99% coverage: 6:396/396 of query aligns to 4:395/395 of 6ducB
- binding (2E)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]-3-[(2-hydroxyphenyl)amino]propanoic acid: H85 (= H87), K86 (= K88), E108 (= E110), T109 (= T111), G110 (= G112), A111 (= A113), G112 (= G114), Q113 (= Q115), H114 (= H116), L165 (= L167), T189 (= T191), G231 (= G233), G232 (= G234), G233 (= G235), S234 (= S236), N235 (= N237), G302 (= G304), F305 (= F307), E349 (= E351), S376 (= S377)
- binding 2-aminopyridine: L4 (= L6), N5 (= N7)
Sites not aligning to the query:
1a50B Crystal structure of wild-type tryptophan synthase complexed with 5- fluoroindole propanol phosphate (see paper)
81% identity, 97% coverage: 6:391/396 of query aligns to 4:390/390 of 1a50B
- active site: K86 (= K88), E108 (= E110), T109 (= T111), T189 (= T191), G231 (= G233), G232 (= G234), G233 (= G235), S234 (= S236), N235 (= N237), S350 (= S352), S376 (= S377)
- binding pyridoxal-5'-phosphate: H85 (= H87), K86 (= K88), T189 (= T191), G231 (= G233), G232 (= G234), G233 (= G235), S234 (= S236), N235 (= N237), E349 (= E351), S376 (= S377), G377 (= G378)
5cgqB Crystal structure of tryptophan synthase from salmonella typhimurium in complex with f9 ligand in the alpha-site and the product l- tryptophan in the beta-site.
81% identity, 97% coverage: 6:391/396 of query aligns to 4:390/390 of 5cgqB
- active site: K86 (= K88), E108 (= E110), S376 (= S377)
- binding pyridoxal-5'-phosphate: H85 (= H87), K86 (= K88), T189 (= T191), G231 (= G233), G233 (= G235), S234 (= S236), N235 (= N237), E349 (= E351), S376 (= S377), G377 (= G378)
- binding tryptophan: K86 (= K88), E108 (= E110), T109 (= T111), G110 (= G112), A111 (= A113), Q113 (= Q115), H114 (= H116), L165 (= L167), T189 (= T191), F305 (= F307)
1qopB Crystal structure of wild-type tryptophan synthase complexed with indole propanol phosphate (see paper)
81% identity, 97% coverage: 6:391/396 of query aligns to 4:390/390 of 1qopB
- binding sodium ion: G231 (= G233), P269 (= P271), F305 (= F307), S307 (= S309)
- binding pyridoxal-5'-phosphate: A84 (= A86), H85 (= H87), K86 (= K88), T189 (= T191), G231 (= G233), G233 (= G235), S234 (= S236), N235 (= N237), E349 (= E351), S376 (= S377), G377 (= G378)
Query Sequence
>7024324 FitnessBrowser__ANA3:7024324
MSQLKLNPYFGEYGGMYVPQILVPALKQLENAFVEAQADESFQAEFTDLLKNYAGRPTAL
TLTRNLSPNPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVAT
ALACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSATLKDACNEAMRDWSG
SYEKAHYLLGTAAGPHPFPTIVREFQRMIGEETKKQMLEREGRLPDAVIACVGGGSNAIG
MFADFIDETSVELIGVEPAGKGIDTHMHGAPLKHGKTGIFFGMKAPLMQDSEGQIEESYS
ISAGLDFPSVGPQHAHLNAIGRARYESATDDEALEAFQLLARSEGIIPALESAHALAYAL
RLAKECTKETILVVNLSGRGDKDIFTVSDILNGKEE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory