Comparing 7024401 FitnessBrowser__ANA3:7024401 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
8gxkB Pseudomonas jinjuensis n-acetyltransferase (see paper)
34% identity, 87% coverage: 17:190/200 of query aligns to 15:182/188 of 8gxkB
1yreB Hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
39% identity, 67% coverage: 57:190/200 of query aligns to 51:182/187 of 1yreB
Sites not aligning to the query:
8gxfB Pseudomonas flexibilis gcn5 family acetyltransferase (see paper)
32% identity, 91% coverage: 9:190/200 of query aligns to 14:182/187 of 8gxfB
>7024401 FitnessBrowser__ANA3:7024401
MGERDLLGCLTGEHVVLEPLSLSHVAALSLAVTDGELWRLWFTSVPEPSEMKAYVTKALD
EKARGESFPFAVRDRLSGEIVGCTRISHWESEHRHLEIGYTWYAKRAQRTGINTESKLLL
LTFAFETLDAIAVEFRTHWHNQASRQAIARLGAKQDGVLRNNKILKDGTIRDTVVYSIID
SEWATVKHNLAFRLQQRPVE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory