Comparing 7024446 FitnessBrowser__ANA3:7024446 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3n2oA X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
69% identity, 99% coverage: 6:635/637 of query aligns to 2:630/630 of 3n2oA
3n2oB X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
69% identity, 99% coverage: 6:635/637 of query aligns to 1:629/629 of 3n2oB
3nzqA Crystal structure of biosynthetic arginine decarboxylase adc (spea) from escherichia coli, northeast structural genomics consortium target er600 (see paper)
57% identity, 98% coverage: 13:635/637 of query aligns to 6:624/628 of 3nzqA
Q9SI64 Arginine decarboxylase 1, chloroplastic; ADC 1; ADC-O; ARGDC 1; AtADC1; EC 4.1.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 96% coverage: 4:616/637 of query aligns to 34:630/702 of Q9SI64
3nzpB Crystal structure of the biosynthetic arginine decarboxylase spea from campylobacter jejuni, northeast structural genomics consortium target br53 (see paper)
32% identity, 98% coverage: 13:634/637 of query aligns to 4:579/591 of 3nzpB
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
24% identity, 41% coverage: 95:356/637 of query aligns to 38:274/394 of 3c5qA
Sites not aligning to the query:
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
24% identity, 41% coverage: 95:356/637 of query aligns to 40:276/405 of B4XMC6
Sites not aligning to the query:
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
26% identity, 43% coverage: 79:355/637 of query aligns to 42:289/418 of 4xg1B
Sites not aligning to the query:
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
26% identity, 28% coverage: 176:355/637 of query aligns to 133:306/434 of 1twiA
Sites not aligning to the query:
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
26% identity, 28% coverage: 176:355/637 of query aligns to 133:306/434 of 1tufA
Sites not aligning to the query:
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
26% identity, 28% coverage: 176:355/637 of query aligns to 137:310/438 of Q58497
Sites not aligning to the query:
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
24% identity, 38% coverage: 124:365/637 of query aligns to 89:323/443 of 5x7mA
Sites not aligning to the query:
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
24% identity, 38% coverage: 124:365/637 of query aligns to 89:323/442 of 5x7nA
Sites not aligning to the query:
7kh2D Structure of n-citrylornithine decarboxylase bound with plp (see paper)
25% identity, 41% coverage: 105:367/637 of query aligns to 55:312/415 of 7kh2D
Sites not aligning to the query:
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
24% identity, 23% coverage: 212:360/637 of query aligns to 163:299/422 of 6n2aA
Sites not aligning to the query:
2nv9B The x-ray crystal structure of the paramecium bursaria chlorella virus arginine decarboxylase (see paper)
25% identity, 22% coverage: 220:357/637 of query aligns to 147:270/372 of 2nv9B
Sites not aligning to the query:
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
24% identity, 42% coverage: 86:355/637 of query aligns to 40:262/393 of 4xg1A
Sites not aligning to the query:
1knwA Crystal structure of diaminopimelate decarboxylase
27% identity, 28% coverage: 175:355/637 of query aligns to 107:283/421 of 1knwA
Sites not aligning to the query:
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
27% identity, 28% coverage: 175:355/637 of query aligns to 108:284/420 of P00861
Sites not aligning to the query:
2nvaA The x-ray crystal structure of the paramecium bursaria chlorella virus arginine decarboxylase bound to agmatine (see paper)
27% identity, 22% coverage: 220:357/637 of query aligns to 147:267/369 of 2nvaA
Sites not aligning to the query:
>7024446 FitnessBrowser__ANA3:7024446
MNDWSIDAARAGYNVTHWSQGFYGISDQGEVTVSPDPKNPDHKIGLNELAKDMVKAGVAL
PVLVRFPQILHHRVNSLCQAFDQAIQKYEYQADYLLVYPIKVNQQKTVVEEILASQASKE
VPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHKVYIVLEKLS
ELKMVLAESKRLGVKPRLGLRARLAFQGKGKWQASGGEKSKFGLSAAQILTVVDQLKQED
MLDSLQLLHFHLGSQIANIRDIRQGVSEAARFYCELRELGASINCFDVGGGLAVDYDGTR
SQSNNSMNYGLSEYANNIVNVLTDICNEYEQPMPRIISESGRHLTAHHAVLITDVIGTEA
YQVEEIQPPAEESPQLLHNMWQSWTEISGRADQRALIEIYHDSQSDLQEAQSLFALGQLS
LAERAWAEQANLRVCHEVQGLLSTKNRYHRPIIDELNEKLADKFFVNFSLFQSLPDAWGI
DQVFPVLPLSGLDKAPERRAVMLDITCDSDGIVDQYVDGQGIETTLPVPAWSAESPYLMG
FFMVGAYQEILGDMHNLFGDTNSAVVSIEENGMTNIESVLAGDTVADVLRYVNLDAVDFM
RTYEELVNQHIAEEERAQILEELQVGLKGYTYLEDFS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory