SitesBLAST
Comparing 7024490 FitnessBrowser__ANA3:7024490 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P35914 Hydroxymethylglutaryl-CoA lyase, mitochondrial; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Homo sapiens (Human) (see 11 papers)
59% identity, 98% coverage: 1:303/310 of query aligns to 18:321/325 of P35914
- E37 (= E20) to K: in HMGCLD; activity lower than 5% respect to the wild-type; mutation to D: Normal activity.
- R41 (= R24) to Q: in HMGCLD; loss of activity and of proton exchange; dbSNP:rs121964997; mutation to M: Reduced activity, and loss of proton exchange.
- D42 (= D25) to E: in HMGCLD; reduced activity; to G: in HMGCLD; loss of activity; dbSNP:rs1467902610; to H: in HMGCLD; loss of activity; mutation D->A,N: Loss of activity, and reduced proton exchange rate.
- K48 (≠ A31) to N: in HMGCLD; abolishes almost all enzymatic activity
- E72 (= E54) mutation to A: Loss of activity, and reduced affinity for metal cofactor and substrate.
- S142 (= S124) to F: in HMGCLD; activity lower than 5% respect to the wild-type
- C174 (= C156) to Y: in HMGCLD; activity lower than 5% respect to the wild-type; dbSNP:rs765475941
- F192 (≠ L174) to S: in HMGCLD; activity lower than 5% respect to the wild-type
- I200 (= I182) to F: in HMGCLD; activity lower than 5% respect to the wild-type
- G203 (= G185) to E: in HMGCLD; complete loss of activity; dbSNP:rs1553131940
- D204 (= D186) mutation to A: Reduced activity, and reduced affinity for metal cofactor and substrate.
- H233 (= H215) to R: in HMGCLD; loss of activity; dbSNP:rs727503963; mutation to A: Loss of activity, and reduced proton exchange rate.
- E279 (= E261) mutation to A: Reduced thermal stability, but normal activity.
- D280 (= D262) mutation to A: Normal activity.
Sites not aligning to the query:
- 323 modified: Interchain; C→S: Abolishes interchain homodimerization. Exhibits no DTT stimulated activity.
3mp3B Crystal structure of human lyase in complex with inhibitor hg-coa (see paper)
61% identity, 93% coverage: 15:303/310 of query aligns to 5:294/296 of 3mp3B
- binding (3R,5S,9R,21S)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9,21-tetrahydroxy-8,8-dimethyl-10,14,19-trioxo-2,4,6-trioxa-18-thia-11,15-diaza-3,5-diphosphatricosan-23-oic acid 3,5-dioxide: R14 (= R24), D15 (= D25), Q18 (= Q28), F49 (= F58), V50 (= V59), S51 (= S60), W54 (= W63), P81 (= P90), N82 (= N91), K84 (= K93), G85 (= G94), N111 (= N120), R122 (= R131), Y140 (= Y149), S142 (= S151), T178 (= T187), H206 (= H215)
- binding magnesium ion: D15 (= D25), H206 (= H215), H208 (= H217)
2cw6A Crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria (see paper)
61% identity, 93% coverage: 15:303/310 of query aligns to 5:294/296 of 2cw6A
3mp5B Crystal structure of human lyase r41m in complex with hmg-coa (see paper)
61% identity, 93% coverage: 15:303/310 of query aligns to 5:294/296 of 3mp5B
- binding 3-hydroxy-3-methylglutaryl-coenzyme a: D15 (= D25), Q18 (= Q28), S51 (= S60), W54 (= W63), F100 (= F109), N111 (= N120), N113 (= N122), Y140 (= Y149), S142 (= S151), T178 (= T187), C239 (= C248)
- binding magnesium ion: D15 (= D25), H206 (= H215), H208 (= H217)
Q8TB92 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; HMGCL-like 1; Endoplasmic reticulum 3-hydroxy-3-methylglutaryl-CoA lyase; er-cHL; EC 4.1.3.4 from Homo sapiens (Human) (see 2 papers)
56% identity, 96% coverage: 5:303/310 of query aligns to 67:366/370 of Q8TB92
- R86 (= R24) mutation to Q: Abolishes catalytic activity.
- L237 (= L174) mutation to S: Abolishes catalytic activity.
- H278 (= H215) mutation to R: Abolishes catalytic activity.
Sites not aligning to the query:
- 2 modified: N-myristoyl glycine; G→A: Abolishes myristoylation and induces a subcellular location change.
P13703 Hydroxymethylglutaryl-CoA lyase; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Pseudomonas mevalonii (see paper)
57% identity, 93% coverage: 16:304/310 of query aligns to 4:293/301 of P13703
- C237 (= C248) active site
1ydnA Crystal structure of the hmg-coa lyase from brucella melitensis, northeast structural genomics target lr35. (see paper)
54% identity, 88% coverage: 13:286/310 of query aligns to 1:275/283 of 1ydnA
6ndsA Structure of an hmg-coa lyase from acenitobacter baumannii in complex with coenzyme a and 3-methylmalate
40% identity, 88% coverage: 9:281/310 of query aligns to 1:273/305 of 6ndsA
- binding coenzyme a: V52 (= V59), S53 (= S60), I57 (≠ V64), N84 (= N91), G87 (= G94), R90 (≠ L97), N113 (= N120), M114 (≠ I121), R115 (≠ N122)
- binding zinc ion: D17 (= D25), H207 (= H215), H209 (= H217)
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
23% identity, 75% coverage: 15:246/310 of query aligns to 21:247/399 of 6ktqA
- binding 2-oxoglutaric acid: R30 (= R24), R154 (= R147), T156 (≠ Y149), E158 (≠ S151), S184 (= S183), T188 (= T187), H216 (= H215), H218 (= H217)
- binding coenzyme a: V67 (≠ W63), R96 (≠ K93), A97 (≠ G94), F116 (= F109), H128 (≠ I121), E158 (≠ S151)
- binding zinc ion: E31 (≠ D25), H216 (= H215), H218 (= H217)
2nx9B Crystal structure of the carboxyltransferase domain of the oxaloacetate decarboxylase na+ pump from vibrio cholerae (see paper)
33% identity, 36% coverage: 170:281/310 of query aligns to 162:266/453 of 2nx9B
Sites not aligning to the query:
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
25% identity, 96% coverage: 13:310/310 of query aligns to 1:291/308 of 3rmjB
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
25% identity, 87% coverage: 13:281/310 of query aligns to 4:268/517 of Q9JZG1
- D16 (= D25) binding
- H204 (= H215) binding
- H206 (= H217) binding
- N240 (= N257) binding
Sites not aligning to the query:
- 366:517 Required for the condensation reaction. Not required to bind substrate
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 55% coverage: 101:271/310 of query aligns to 180:342/503 of Q9FN52
- G263 (= G189) mutation to E: In gsm2-1; loss of activity and lack of C6, C7 and C8 aliphatic glucosinolates.
6e1jA Crystal structure of methylthioalkylmalate synthase (bjumam1.1) from brassica juncea (see paper)
23% identity, 83% coverage: 16:271/310 of query aligns to 18:275/409 of 6e1jA
- binding coenzyme a: Q30 (= Q28), F60 (≠ S57), S63 (= S60), I95 (≠ V84), R97 (≠ S86), F121 (= F109), K132 (≠ N120), L133 (≠ I121)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: P192 (≠ G185), T194 (= T187), H225 (= H215), H227 (= H217)
- binding manganese (ii) ion: D27 (= D25), V82 (≠ I77), E84 (≠ R79), H225 (= H215), H227 (= H217)
Sites not aligning to the query:
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 55% coverage: 101:271/310 of query aligns to 180:342/506 of Q9FG67
- A290 (= A213) mutation to T: In gsm1-2; loss of conversion of C3 to C4 glucosinolates.
Sites not aligning to the query:
- 102 S→F: In gsm1-1; loss of conversion of C3 to C4 glucosinolates.
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
22% identity, 86% coverage: 14:281/310 of query aligns to 33:293/418 of Q9Y823
- R43 (= R24) binding ; mutation R->A,K,Q: Abolishes the catalytic activity.
- E44 (≠ D25) binding ; binding ; binding
- Q47 (= Q28) mutation to A: Abolishes the catalytic activity.
- E74 (= E54) mutation to A: Abolishes the catalytic activity.; mutation to Q: Results in a moderate decrease in the turnover number and a slight increase in the Km value for each substrate.
- H103 (≠ Q76) binding ; mutation to A: Substantially impairs catalytic efficiency.
- D123 (≠ E96) binding ; mutation to N: Does not affect the catalytic activity but impairs L-lysine inhibition.
- R163 (= R147) binding ; mutation R->A,Q: Abolishes the catalytic activity.; mutation to K: Severely diminishes affinity for 2-oxoglutarate and substantially impairs catalytic efficiency.
- S165 (≠ P157) binding ; mutation to A: Results in a moderate decrease in catalytic efficiency.
- E167 (= E159) mutation E->A,Q: Abolishes the catalytic activity.
- T197 (= T187) binding ; binding ; mutation to A: Exhibits a 25-fold decrease in catalytic efficiency.; mutation to S: Results in a modest decrease in catalytic efficiency.; mutation to V: Abolishes the catalytic activity.
- E222 (≠ A213) mutation to Q: Does not affect the catalytic activity but impairs L-lysine inhibition.
- H224 (= H215) binding ; binding
- H226 (= H217) binding ; binding
- R288 (≠ I276) mutation to K: Does not affect the catalytic activity but impairs L-lysine inhibition.
Sites not aligning to the query:
- 332 Y→A: Abolishes the catalytic activity.; Y→F: Results in a decrease in catalytic efficiency.
- 364 Q→R: Does not affect the catalytic activity but impairs L-lysine inhibition.
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
22% identity, 86% coverage: 14:281/310 of query aligns to 28:288/400 of 3ivtB
2zyfA Crystal structure of homocitrate synthase from thermus thermophilus complexed with magnesuim ion and alpha-ketoglutarate (see paper)
25% identity, 72% coverage: 24:246/310 of query aligns to 12:220/314 of 2zyfA
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
26% identity, 72% coverage: 24:246/310 of query aligns to 12:226/376 of O87198
- R12 (= R24) binding
- E13 (≠ D25) binding
- H72 (≠ S86) binding ; mutation to L: Significant decrease in sensitivity to lysine inhibition. Large decrease in affinity for 2-oxoglutarate. Almost no effect on affinity for acetyl-CoA and on turnover number.
- D92 (≠ E96) binding
- R133 (= R147) binding
- S135 (≠ Y149) binding
- T166 (= T187) binding ; binding
- H195 (= H215) binding
- H197 (= H217) binding
2ztjA Crystal structure of homocitrate synthase from thermus thermophilus complexed with alpha-ketoglutarate (see paper)
27% identity, 72% coverage: 24:246/310 of query aligns to 12:218/312 of 2ztjA
Query Sequence
>7024490 FitnessBrowser__ANA3:7024490
MSALDLSTLSASSDRVSLFEMGPRDGLQNEAAVPTQAKVALIESLADAGVKRIEAGSFVS
PKWVPQMADSGDVLRQIRRQAGVVYSALTPNVKGLELALDAKASEVAIFGAASQSFSQRN
INCSIEESIERFIPLMDMAKAANIPVRGYVSCVLGCPYEGEIAASEVARVSEILYKMGCY
EISLGDTIGVGTPLKARKMLQAVMERVPVEMLALHFHDTYGQALANITACLDLGVRSFDA
SVAGLGGCPYAKGASGNLASEDLVYMLHGLGLKTGIDLEKLALAGFGISKQLNRLNGSKV
ANAILQGAKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory