Comparing 7024499 FitnessBrowser__ANA3:7024499 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2w90B Geobacillus stearothermophilus 6-phosphogluconate dehydrogenase with bound 6- phosphogluconate (see paper)
50% identity, 97% coverage: 4:498/508 of query aligns to 2:469/471 of 2w90B
P78812 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
48% identity, 97% coverage: 9:500/508 of query aligns to 8:480/492 of P78812
2iz1B 6pdh complexed with pex inhibitor synchrotron data (see paper)
45% identity, 98% coverage: 3:498/508 of query aligns to 1:470/471 of 2iz1B
2iypB Product rup (see paper)
46% identity, 97% coverage: 4:498/508 of query aligns to 1:469/470 of 2iypB
2iypA Product rup (see paper)
46% identity, 96% coverage: 9:498/508 of query aligns to 5:468/469 of 2iypA
2iyoA Structural characterization of a bacterial 6pdh reveals aspects of specificity, mechanism and mode of inhibition (see paper)
46% identity, 96% coverage: 9:498/508 of query aligns to 5:468/470 of 2iyoA
P96789 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Lactococcus lactis subsp. cremoris (strain MG1363) (see paper)
46% identity, 96% coverage: 9:498/508 of query aligns to 5:468/472 of P96789
8i4qA Crystal structure of 6-phosphogluconate dehydrogenase from corynebacterium glutamicum (see paper)
44% identity, 97% coverage: 6:499/508 of query aligns to 1:471/479 of 8i4qA
2jkvA Structure of human phosphogluconate dehydrogenase in complex with NADPH at 2.53a
44% identity, 97% coverage: 9:500/508 of query aligns to 4:470/482 of 2jkvA
Sites not aligning to the query:
P52209 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Homo sapiens (Human)
44% identity, 97% coverage: 9:500/508 of query aligns to 5:471/483 of P52209
Sites not aligning to the query:
2p4qA Crystal structure analysis of gnd1 in saccharomyces cerevisiae (see paper)
44% identity, 97% coverage: 9:499/508 of query aligns to 4:476/476 of 2p4qA
5uq9E Crystal structure of 6-phosphogluconate dehydrogenase with ((4r,5r)-5- (hydroxycarbamoyl)-2,2-dimethyl-1,3-dioxolan-4-yl)methyl dihydrogen phosphate (see paper)
44% identity, 96% coverage: 9:498/508 of query aligns to 4:468/468 of 5uq9E
7cb2A The 6-phosphogluconate dehydrogenase (NADP-bound) from staphylococcus aureus
45% identity, 96% coverage: 10:498/508 of query aligns to 5:465/466 of 7cb2A
7cb5B The 6-phosphogluconate dehydrogenase from staphylococcus aureus (6- phosphogluconate bound) (see paper)
45% identity, 96% coverage: 10:498/508 of query aligns to 5:465/467 of 7cb5B
1pgqA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
45% identity, 97% coverage: 9:500/508 of query aligns to 4:470/473 of 1pgqA
1pgpA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
45% identity, 97% coverage: 9:500/508 of query aligns to 4:470/473 of 1pgpA
1pgoA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
45% identity, 97% coverage: 9:500/508 of query aligns to 4:470/473 of 1pgoA
1pgnA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
45% identity, 97% coverage: 9:500/508 of query aligns to 4:470/473 of 1pgnA
P00350 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Escherichia coli (strain K12) (see paper)
45% identity, 96% coverage: 10:498/508 of query aligns to 6:466/468 of P00350
3fwnB Dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate (see paper)
45% identity, 96% coverage: 10:498/508 of query aligns to 5:465/467 of 3fwnB
>7024499 FitnessBrowser__ANA3:7024499
MQNHSNLNDIGVIGLGVMGKNLALNIADNQYRVSAFDLDPVKVNGVLQQEKQERVGQELR
ITGCANLSEMLASLAHPRILVLSVPAGAPVDGVCHALISAGIEADDIVIDTGNSLWTDTV
EREKRYQGKFIFFSSAVSGGEVGARFGPSLMPSGDLGAWQNVAPIWKAIAAKVDPQTGLP
IERFEPGNPVTDGEPCTTYIGPAGAGHYVKMVHNGIEYADMQLICEAYQLMLDGLGMSAA
QVGEVFERWNKGSLNSYLMGISAEVLKQADPLTGQPLVEMILDKAGQKGTGLWTAVSSLQ
IGCPAPTIAEAVYARAVSTQKSLRVELSKKLAGPASVAMDDAQKASLIDALESALYCAKV
CCYAQGFQLMAMTAQEQKWQLDFAEIAKIWRAGCIIRATFLQSITQAYQADADLSCLLMA
DIFATTLSEKQTEWRSAVAAAVMQGIPVPCISSALAYYDSYRSETLPANLLQGQRDFFGA
HTFERLDKPAGEKYHLDWSAPNRVLIKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory