SitesBLAST
Comparing 7024516 FitnessBrowser__ANA3:7024516 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0CH37 NADP-dependent alcohol dehydrogenase C 2; Ms-ADHC 2; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
54% identity, 98% coverage: 1:342/348 of query aligns to 1:343/349 of P0CH37
- K210 (≠ S209) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P0CH36 NADP-dependent alcohol dehydrogenase C 1; Ms-ADHC 1; EC 1.1.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
54% identity, 98% coverage: 1:342/348 of query aligns to 1:343/349 of P0CH36
- K210 (≠ S209) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P9WQC5 NADP-dependent alcohol dehydrogenase C; EC 1.1.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
51% identity, 99% coverage: 1:345/348 of query aligns to 1:345/346 of P9WQC5
- K209 (≠ S209) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
1uufA Crystal structure of a zinc-type alcohol dehydrogenase-like protein yahk
54% identity, 96% coverage: 8:342/348 of query aligns to 6:334/339 of 1uufA
- active site: C38 (= C40), H39 (= H41), S40 (= S42), H43 (= H45), H60 (= H62), E61 (= E63), C91 (= C93), C94 (= C96), C97 (= C99), C105 (= C107), T109 (= T112), C156 (= C158), T160 (= T162), R330 (= R338)
- binding zinc ion: C38 (= C40), H60 (= H62), C91 (= C93), C94 (= C96), C97 (= C99), C105 (= C107), C156 (= C158)
Sites not aligning to the query:
6k3gB Crystal structure of 10-hydroxygeraniol dehydrogenase from cantharanthus roseus in complex with NADP+ (see paper)
50% identity, 99% coverage: 1:343/348 of query aligns to 8:350/356 of 6k3gB
- active site: C47 (= C40), S49 (= S42), H52 (= H45), H69 (= H62), C163 (= C158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H48 (= H41), S49 (= S42), H52 (= H45), W58 (= W51), C163 (= C158), T167 (= T162), G188 (= G182), L189 (≠ M183), G190 (= G184), G191 (= G185), L192 (= L186), S211 (= S205), T212 (≠ R206), S213 (= S207), K216 (= K210), T251 (= T244), V252 (= V245), S253 (≠ P246), A254 (≠ T247), V274 (= V267), G275 (= G268), A276 (≠ Q269), A299 (≠ L292), I300 (= I293), R345 (= R338)
- binding zinc ion: C47 (= C40), H69 (= H62), C100 (= C93), C103 (= C96), C106 (= C99), C114 (= C107), C163 (= C158)
1yqdA Sinapyl alcohol dehydrogenase complexed with NADP+ (see paper)
45% identity, 99% coverage: 1:343/348 of query aligns to 8:350/359 of 1yqdA
- active site: C47 (= C40), H48 (= H41), S49 (= S42), H52 (= H45), H69 (= H62), E70 (= E63), C100 (= C93), C103 (= C96), C106 (= C99), C114 (= C107), I118 (≠ T112), C163 (= C158), T167 (= T162), R345 (= R338)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C47 (= C40), H48 (= H41), S49 (= S42), H52 (= H45), C163 (= C158), T167 (= T162), G188 (= G182), L189 (≠ M183), G190 (= G184), G191 (= G185), L192 (= L186), S211 (= S205), T212 (≠ R206), S213 (= S207), K216 (= K210), T251 (= T244), V252 (= V245), S253 (≠ P246), V274 (= V267), G275 (= G268), A276 (≠ Q269), G299 (≠ L292), I300 (= I293), N340 (≠ S333), R345 (= R338)
- binding zinc ion: C47 (= C40), H69 (= H62), C100 (= C93), C103 (= C96), C106 (= C99), C114 (= C107), C163 (= C158)
5z0cA Nerol dehydrogenase from persicaria minor (see paper)
46% identity, 99% coverage: 1:343/348 of query aligns to 5:347/367 of 5z0cA
- active site: C44 (= C40), S46 (= S42), H49 (= H45), H66 (= H62), C160 (= C158)
- binding zinc ion: C44 (= C40), H66 (= H62), C97 (= C93), C100 (= C96), C103 (= C99), C111 (= C107), C160 (= C158)
3twoB The crystal structure of cad from helicobacter pylori complexed with NADP(h) (see paper)
43% identity, 99% coverage: 1:346/348 of query aligns to 3:346/348 of 3twoB
- active site: C42 (= C40), H43 (= H41), S44 (= S42), H47 (= H45), H64 (= H62), E65 (= E63), C95 (= C93), C98 (= C96), C101 (= C99), C109 (= C107), V113 (≠ T112), C160 (= C158), T164 (= T162), R338 (= R338)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: C42 (= C40), H43 (= H41), S44 (= S42), H47 (= H45), C160 (= C158), T164 (= T162), G184 (= G182), F185 (≠ M183), G186 (= G184), G187 (= G185), L188 (= L186), R208 (= R206), T241 (= T244), I242 (≠ V245), P243 (= P246), T244 (= T247), V264 (= V267), G265 (= G268), L266 (vs. gap), L292 (= L292), I293 (= I293), L330 (= L330), G333 (≠ S333), R338 (= R338)
- binding zinc ion: C42 (= C40), H64 (= H62), C95 (= C93), C98 (= C96), C101 (= C99), C109 (= C107), C160 (= C158)
5vktA Cinnamyl alcohol dehydrogenases (sbcad4) from sorghum bicolor (l.) Moench (see paper)
46% identity, 98% coverage: 5:346/348 of query aligns to 5:348/353 of 5vktA
- active site: C40 (= C40), H41 (= H41), T42 (≠ S42), H45 (= H45), H62 (= H62), E63 (= E63), C93 (= C93), C96 (= C96), C99 (= C99), C107 (= C107), V111 (≠ T112), C158 (= C158), T162 (= T162), R340 (= R338)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C40 (= C40), H41 (= H41), T42 (≠ S42), H45 (= H45), C158 (= C158), T162 (= T162), G183 (= G182), L184 (≠ M183), G185 (= G184), G186 (= G185), L187 (= L186), S206 (= S205), S207 (≠ R206), S208 (= S207), K211 (= K210), T246 (= T244), V247 (= V245), S248 (≠ P246), A249 (≠ T247), V269 (= V267), G270 (= G268), N293 (≠ S291), G294 (≠ L292), N335 (≠ S333), R340 (= R338)
- binding zinc ion: C40 (= C40), H62 (= H62), C93 (= C93), C96 (= C96), C99 (= C99), C107 (= C107), C158 (= C158)
7cguA Crystal structure of abhar
44% identity, 99% coverage: 2:344/348 of query aligns to 3:346/352 of 7cguA
8a3nB Geissoschizine synthase from catharanthus roseus - binary complex with NADP+ (see paper)
41% identity, 99% coverage: 1:343/348 of query aligns to 5:345/352 of 8a3nB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: N45 (≠ H41), V161 (≠ T162), G182 (= G182), L183 (≠ M183), L186 (= L186), S205 (= S205), T206 (≠ R206), K210 (= K210), T245 (= T244), P247 (= P246), V269 (= V267), A271 (≠ Q269), S294 (≠ L292), L335 (≠ S333), R340 (= R338)
- binding zinc ion: C44 (= C40), H66 (= H62), E67 (= E63), C97 (= C93), C100 (= C96), C103 (= C99), C111 (= C107), C157 (= C158)
2cf6A Crystal structures of the arabidopsis cinnamyl alcohol dehydrogenases atcad5 (see paper)
46% identity, 100% coverage: 2:348/348 of query aligns to 4:350/352 of 2cf6A
- active site: C42 (= C40), H43 (= H41), T44 (≠ S42), H47 (= H45), H64 (= H62), E65 (= E63), C95 (= C93), C98 (= C96), C101 (= C99), C109 (= C107), I113 (≠ F111), C158 (= C158), T162 (= T162), R340 (= R338)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H43 (= H41), T44 (≠ S42), T162 (= T162), L184 (≠ M183), G185 (= G184), G186 (= G185), V187 (≠ L186), S206 (= S205), S207 (≠ R206), K211 (= K210), T246 (= T244), M269 (≠ V267), S293 (= S291), F294 (≠ L292), I295 (= I293)
- binding zinc ion: C42 (= C40), H64 (= H62), E65 (= E63), C98 (= C96), C109 (= C107)
2cf5A Crystal structures of the arabidopsis cinnamyl alcohol dehydrogenases, atcad5 (see paper)
46% identity, 100% coverage: 2:348/348 of query aligns to 4:350/352 of 2cf5A
- active site: C42 (= C40), H43 (= H41), T44 (≠ S42), H47 (= H45), H64 (= H62), E65 (= E63), C95 (= C93), C98 (= C96), C101 (= C99), C109 (= C107), I113 (≠ F111), C158 (= C158), T162 (= T162), R340 (= R338)
- binding zinc ion: C42 (= C40), H64 (= H62), E65 (= E63), C95 (= C93), C98 (= C96), C101 (= C99), C109 (= C107), C158 (= C158)
O49482 Cinnamyl alcohol dehydrogenase 5; AtCAD5; Cinnamyl alcohol dehydrogenase D; EC 1.1.1.195 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
46% identity, 100% coverage: 2:348/348 of query aligns to 9:355/357 of O49482
- C47 (= C40) binding
- T49 (≠ S42) binding
- H69 (= H62) binding
- E70 (= E63) binding ; mutation to A: Loss of activity.
- C100 (= C93) binding
- C103 (= C96) binding
- C106 (= C99) binding
- C114 (= C107) binding
- C163 (= C158) binding
- T167 (= T162) binding
- GLGGVG 188:193 (≠ GMGGLG 182:187) binding
- SSSNKK 211:216 (≠ SRSESK 205:210) binding
- T251 (= T244) binding
- G275 (= G268) binding
- SFI 298:300 (≠ SLI 291:293) binding
Q6ZHS4 Cinnamyl alcohol dehydrogenase 2; OsCAD2; Protein GOLD HULL AND INTERNODE 2; EC 1.1.1.195 from Oryza sativa subsp. japonica (Rice) (see paper)
46% identity, 99% coverage: 5:348/348 of query aligns to 12:355/363 of Q6ZHS4
- G185 (≠ A179) mutation to D: Loss of activity.
5fi3A Heteroyohimbine synthase thas1 from catharanthus roseus - complex with NADP+ (see paper)
40% identity, 99% coverage: 1:343/348 of query aligns to 4:338/344 of 5fi3A
- active site: C43 (= C40), Q44 (≠ H41), Y45 (≠ S42), E48 (≠ H45), H65 (= H62), E66 (= E63), C96 (= C93), C99 (= C96), C102 (= C99), C110 (= C107), G114 (≠ F111), C151 (= C158), R333 (= R338)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Q44 (≠ H41), E48 (≠ H45), T155 (= T162), G176 (= G182), L177 (≠ M183), G178 (= G184), G179 (= G185), L180 (= L186), S199 (= S205), S200 (≠ R206), K204 (= K210), T239 (= T244), I240 (≠ V245), P241 (= P246), L262 (≠ V267), G263 (= G268), T287 (≠ L292), S328 (= S333)
- binding zinc ion: C43 (= C40), H65 (= H62), E66 (= E63), C96 (= C93), C99 (= C96), C102 (= C99), C110 (= C107), C151 (= C158)
5h83A Heteroyohimbine synthase hys from catharanthus roseus - apo form (see paper)
42% identity, 99% coverage: 1:343/348 of query aligns to 9:347/354 of 5h83A
8b25B Dihydroprecondylocarpine acetate synthase 2 from tabernanthe iboga - stemmadenine acetate bound structure (see paper)
42% identity, 95% coverage: 15:344/348 of query aligns to 23:352/359 of 8b25B
8b1vA Dihydroprecondylocarpine acetate synthase 2 from tabernanthe iboga (see paper)
42% identity, 95% coverage: 15:344/348 of query aligns to 23:352/358 of 8b1vA
5h81B Heteroyohimbine synthase thas2 from catharanthus roseus - complex with NADP+ (see paper)
38% identity, 99% coverage: 1:346/348 of query aligns to 2:351/354 of 5h81B
- active site: A343 (≠ R338)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V174 (≠ T162), F196 (≠ M183), G197 (= G184), R198 (≠ G185), I199 (≠ L186), S218 (= S205), T219 (≠ R206), S220 (= S207), K223 (= K210), V259 (= V245), P260 (= P246), L281 (≠ V267), I297 (≠ L292)
- binding zinc ion: C41 (= C40), H63 (= H62), E64 (= E63), C94 (= C93), C97 (= C96), C100 (= C99), C108 (= C107), C170 (= C158)
Query Sequence
>7024516 FitnessBrowser__ANA3:7024516
MQTIGYAAASAQSPLEPYHYECRELRDNDVAIEILYSGVCHSDLHTVKNDWGWTVYPTVP
GHEIVGRVVQVGSQVNKYKVGDHVAVGCMVDSCQECTHCHHGEEQFCEQGFTQTYNSADR
QTQELTKGGYAKHIVVRQEFVLSIPTSLDLAKVAPLLCAGITTYSPLRTWNVGPGSQVAV
IGMGGLGHMAIKLAAAMGAHVTVLSRSESKRSDALELGASDFLISSDLERMQQAANRFEL
IIDTVPTKHDITPYLPLLNVDGTLTLVGQVGPIAEVNTVPMVMGRRRIAASLIGGIAETQ
EMLDFCGRMNILPEVEMIKMEQINEAFERLEKSDVHYRFVIDMQASSF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory