SitesBLAST
Comparing 7024559 FitnessBrowser__ANA3:7024559 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
27% identity, 45% coverage: 84:540/1013 of query aligns to 74:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: G75 (= G85), S76 (≠ G86), G77 (= G87), T78 (= T88), G79 (= G89), L80 (≠ T90), A83 (≠ Q93), C84 (≠ S94), P137 (≠ S147), G138 (≠ T148), E139 (≠ S149), A142 (= A152), T143 (= T153), G146 (= G156), N147 (≠ M157), S149 (≠ N159), T150 (= T160), A152 (= A162), G153 (≠ S163), E203 (= E267), G204 (= G268), I209 (= I273), E422 (= E500), H423 (= H501)
- binding fe (iii) ion: H377 (= H456), H384 (= H463), E422 (= E500)
Sites not aligning to the query:
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
22% identity, 52% coverage: 18:541/1013 of query aligns to 5:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ N45), P68 (≠ T80), G70 (≠ S82), T71 (≠ A83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ V103), P132 (≠ L146), G133 (≠ S147), A134 (≠ T148), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E267), G201 (= G268), I206 (= I273), W322 (vs. gap), E413 (= E500), H414 (= H501), N450 (= N536)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R403), H369 (= H456), H376 (= H463), H414 (= H501)
- binding manganese (ii) ion: H369 (= H456), H376 (= H463), E413 (= E500)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
22% identity, 52% coverage: 18:541/1013 of query aligns to 5:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ G87), R317 (= R403), W321 (vs. gap), H368 (= H456), H375 (= H463), H413 (= H501)
- binding flavin-adenine dinucleotide: P68 (≠ T80), G70 (≠ S82), T71 (≠ A83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ V103), P132 (≠ L146), G133 (≠ S147), A134 (≠ T148), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E267), G201 (= G268), I206 (= I273), W321 (vs. gap), Y322 (≠ V407), E412 (= E500), H413 (= H501), N449 (= N536)
- binding manganese (ii) ion: H368 (= H456), H375 (= H463), E412 (= E500)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
22% identity, 52% coverage: 18:541/1013 of query aligns to 5:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ N45), P68 (≠ T80), G70 (≠ S82), T71 (≠ A83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ V103), P132 (≠ L146), G133 (≠ S147), A134 (≠ T148), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E267), G201 (= G268), I206 (= I273), W323 (vs. gap), E414 (= E500), H415 (= H501), N451 (= N536)
- binding manganese (ii) ion: H370 (= H456), H377 (= H463), E414 (= E500)
- binding pyruvic acid: R319 (= R403), H370 (= H456), H377 (= H463), H415 (= H501)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
22% identity, 52% coverage: 18:541/1013 of query aligns to 5:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (≠ T80), G70 (≠ S82), T71 (≠ A83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ V103), P132 (≠ L146), G133 (≠ S147), A134 (≠ T148), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E267), G201 (= G268), I206 (= I273), W322 (vs. gap), E413 (= E500), H414 (= H501), N450 (= N536)
- binding lactic acid: R318 (= R403), H369 (= H456), H376 (= H463), H414 (= H501)
- binding manganese (ii) ion: H369 (= H456), H376 (= H463), E413 (= E500)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
22% identity, 52% coverage: 18:541/1013 of query aligns to 5:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R403), W322 (vs. gap), H369 (= H456), H376 (= H463), H414 (= H501)
- binding flavin-adenine dinucleotide: P68 (≠ T80), G70 (≠ S82), T71 (≠ A83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ V103), P132 (≠ L146), G133 (≠ S147), A134 (≠ T148), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E267), G201 (= G268), I206 (= I273), W322 (vs. gap), E413 (= E500), N450 (= N536)
- binding manganese (ii) ion: H369 (= H456), H376 (= H463), E413 (= E500)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
22% identity, 52% coverage: 18:541/1013 of query aligns to 5:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R403), H369 (= H456), H376 (= H463), H414 (= H501)
- binding flavin-adenine dinucleotide: P68 (≠ T80), G70 (≠ S82), T71 (≠ A83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ V103), P132 (≠ L146), G133 (≠ S147), A134 (≠ T148), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E267), G201 (= G268), I206 (= I273), W322 (vs. gap), E413 (= E500), H414 (= H501), N450 (= N536)
- binding manganese (ii) ion: H369 (= H456), H376 (= H463), E413 (= E500)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
22% identity, 52% coverage: 18:541/1013 of query aligns to 5:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R403), W322 (vs. gap), H369 (= H456), H376 (= H463), H413 (= H501)
- binding flavin-adenine dinucleotide: E32 (≠ N45), P68 (≠ T80), G70 (≠ S82), T71 (≠ A83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ V103), P132 (≠ L146), G133 (≠ S147), A134 (≠ T148), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E267), G201 (= G268), I206 (= I273), W322 (vs. gap), E412 (= E500), H413 (= H501), N449 (= N536)
- binding manganese (ii) ion: H369 (= H456), H376 (= H463), E412 (= E500)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
22% identity, 52% coverage: 18:541/1013 of query aligns to 5:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R403), W322 (vs. gap), S336 (≠ A423), H369 (= H456), H376 (= H463), H413 (= H501)
- binding flavin-adenine dinucleotide: P68 (≠ T80), G70 (≠ S82), T71 (≠ A83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ V103), P132 (≠ L146), G133 (≠ S147), A134 (≠ T148), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E267), G201 (= G268), I206 (= I273), E412 (= E500), N449 (= N536)
- binding manganese (ii) ion: H369 (= H456), H376 (= H463), E412 (= E500)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
22% identity, 52% coverage: 18:541/1013 of query aligns to 5:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (≠ T80), G70 (≠ S82), T71 (≠ A83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ V103), P132 (≠ L146), G133 (≠ S147), A134 (≠ T148), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E267), G201 (= G268), I206 (= I273), Y324 (≠ V407), H370 (= H456), E414 (= E500), N451 (= N536)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R403), W323 (vs. gap), H415 (= H501)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
22% identity, 52% coverage: 18:541/1013 of query aligns to 5:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R403), W323 (vs. gap), H370 (= H456), H415 (= H501)
- binding flavin-adenine dinucleotide: P68 (≠ T80), G70 (≠ S82), T71 (≠ A83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ V103), P132 (≠ L146), G133 (≠ S147), A134 (≠ T148), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E267), G201 (= G268), I206 (= I273), H370 (= H456), E414 (= E500), N451 (= N536)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
22% identity, 52% coverage: 18:541/1013 of query aligns to 5:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R403), W323 (vs. gap), H415 (= H501)
- binding flavin-adenine dinucleotide: P68 (≠ T80), G70 (≠ S82), T71 (≠ A83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ V103), P132 (≠ L146), G133 (≠ S147), A134 (≠ T148), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E267), G201 (= G268), I206 (= I273), Y324 (≠ V407), H370 (= H456), E414 (= E500), N451 (= N536)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
22% identity, 52% coverage: 18:541/1013 of query aligns to 5:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (≠ T80), G70 (≠ S82), T71 (≠ A83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ V103), P132 (≠ L146), G133 (≠ S147), A134 (≠ T148), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E267), G201 (= G268), I206 (= I273), H370 (= H456), E414 (= E500), N451 (= N536)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R403), W323 (vs. gap), H415 (= H501)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
22% identity, 52% coverage: 18:541/1013 of query aligns to 5:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (≠ T80), G70 (≠ S82), T71 (≠ A83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ V103), P132 (≠ L146), G133 (≠ S147), A134 (≠ T148), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E267), G201 (= G268), I206 (= I273), H370 (= H456), E414 (= E500), N451 (= N536)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R403), H415 (= H501)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
22% identity, 52% coverage: 18:541/1013 of query aligns to 5:456/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (≠ T80), G70 (≠ S82), T71 (≠ A83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ V103), P132 (≠ L146), G133 (≠ S147), A134 (≠ T148), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E267), G201 (= G268), I206 (= I273), Y324 (≠ V407), H370 (= H456), E414 (= E500), N451 (= N536)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ G87), R319 (= R403), W323 (vs. gap), H415 (= H501)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
24% identity, 49% coverage: 53:546/1013 of query aligns to 101:521/521 of Q8N465
- S109 (≠ Q61) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ S82) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G86) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (= I100) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (= M107) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- 169:521 (vs. 123:546, 24% identical) natural variant: Missing (in D2HGA1; uncertain significance)
- C172 (≠ V126) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ S143) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ N159) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ I185) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G187) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (= D392) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R403) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ V407) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ A421) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- 400:521 (vs. 422:546, 29% identical) natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- K401 (≠ A423) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (= R441) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ N448) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H456) binding ; mutation to A: Loss of catalytic activity.
- G436 (≠ D458) to V: slight reduction in catalytic activity
- N439 (≠ V461) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H463) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ R465) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ P466) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ C471) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E500) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H501) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G502) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
22% identity, 52% coverage: 18:541/1013 of query aligns to 5:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (≠ T80), G70 (≠ S82), T71 (≠ A83), G72 (≠ R84), T73 (≠ G85), G74 (= G86), G78 (≠ T90), V79 (≠ N91), L90 (≠ V103), P132 (≠ L146), G133 (≠ S147), A134 (≠ T148), G140 (= G156), M141 (= M157), A143 (≠ N159), T144 (= T160), A146 (= A162), S147 (= S163), E200 (= E267), G201 (= G268), I206 (= I273), H369 (= H456), E413 (= E500), N450 (= N536)
- binding deaminohydroxyvaline: R319 (= R403), H414 (= H501)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
24% identity, 48% coverage: 53:539/1013 of query aligns to 49:463/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (≠ A83), G78 (= G85), G79 (= G86), N80 (≠ G87), T81 (= T88), G82 (= G89), M83 (≠ T90), G86 (≠ Q93), S87 (= S94), L140 (= L146), A142 (≠ T148), C146 (≠ A152), H147 (≠ T153), G150 (= G156), N151 (≠ M157), A153 (≠ N159), T154 (= T160), G208 (= G268), I212 (≠ V272), I213 (= I273), E423 (= E500), N460 (= N536)
Sites not aligning to the query:
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
24% identity, 48% coverage: 53:539/1013 of query aligns to 48:462/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R403), T337 (≠ V407), K348 (≠ A423), Y379 (≠ F454), H381 (= H456), H388 (= H463), H423 (= H501)
- binding flavin-adenine dinucleotide: P75 (≠ A83), Q76 (≠ R84), G77 (= G85), G78 (= G86), N79 (≠ G87), T80 (= T88), G81 (= G89), M82 (≠ T90), G85 (≠ Q93), S86 (= S94), L139 (= L146), G140 (≠ S147), A141 (≠ T148), C145 (≠ A152), G149 (= G156), N150 (≠ M157), A152 (≠ N159), T153 (= T160), G157 (= G164), G207 (= G268), I212 (= I273), E422 (= E500), N459 (= N536)
- binding zinc ion: H381 (= H456), H388 (= H463), E422 (= E500)
Sites not aligning to the query:
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
24% identity, 48% coverage: 53:539/1013 of query aligns to 48:462/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (≠ A83), G77 (= G85), G78 (= G86), N79 (≠ G87), T80 (= T88), G81 (= G89), G85 (≠ Q93), S86 (= S94), L139 (= L146), G140 (≠ S147), A141 (≠ T148), C145 (≠ A152), H146 (≠ T153), G148 (= G155), G149 (= G156), N150 (≠ M157), A152 (≠ N159), T153 (= T160), A155 (= A162), E206 (= E267), G207 (= G268), I211 (≠ V272), I212 (= I273), E422 (= E500), N459 (= N536)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R403), T337 (≠ V407), K348 (≠ A423), Y379 (≠ F454), H381 (= H456), H388 (= H463), H423 (= H501)
- binding zinc ion: H381 (= H456), H388 (= H463), E422 (= E500)
Sites not aligning to the query:
Query Sequence
>7024559 FitnessBrowser__ANA3:7024559
MLPLLSHQQTLEPVYLAYLDALAQSGYAGDIDKRYSARLVQATDNSVYQFLPQAVLYPKH
QKDIQIALSLAAKAEFAGVTFSARGGGTGTNGQSLTHGLILDVSRYMNRVLEVNHEQGWV
RVEAGVVKDALNDALRPHGYFFSPDLSTSNRATIGGMINTDASGAGSLVYGKTSDHVLAL
RSILIDGSVFDTRPLDAGLLCNPDNVSDNPLGQKLISAIAEVCREKRALIEQQFPKLNRF
LTGYDLKNVWNNGLTQFDLSRILTGSEGTLAVITEAKLNITPLPSERAMVNIKYDSFQSA
LRHAPSLVAARATVVETVDSKVLNLAREDIVWHSVSDLIQEVPGKVIDGLNMVEFAGDAV
EVSEKLAALEAVLTEQINRGECGVVGYQVTQDKASIEKIYGMRKKAVGLLGATKGRRKPI
AFAEDTAVPPEMLADYIMEFRALLDSHNLQYGMFGHVDAGVLHVRPALDMCDVEDEKLLR
VISDQVAALTLKYGGLMWGEHGKGVRGEYGPSVFGDELYGVLQDIKGLFDPDNRLNPGKL
VAPKQAGGLCFDVDSTKRGKFDRQIPVEVRDAYPDVMNCNGNGLCFNYSSFSPMCPSFKV
TGDRVQSPKGRAGLMREWLRLLESEGVDVNALARAKPLGILQRMQNTINAKRDYDYSHEV
MESLKGCLACKACSSQCPVKVDVPKFRAQFFNIYYQRYLRPAKDYLVAGIEDSLPIMAAA
PRLTNFASQNPLSQWVIKKAIGYVDAPALSVPTLKQRLDGHASRGYDLAALQAIPADERA
KFVLVVQDPFNSFYDAGLVYRFVQLIETLGLKPVLLPFKPNGKPTHIKGFLDKFAKTAQS
SADFLNQVHKLGMPMVGIDPALVLCYRDEYKEILGANRGAFEVKLANEWLLSILQDIPTK
AMQDKQFTWFSHCTESTAKPNTANEWSKIFTHFGAKLTAVNLGCCGMAGTYGHEAENLER
SKTLFDMSWKDTLSRIDASQVLVSGYSCRSQVKRFAGYKPKHPLEALLELVKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory