SitesBLAST
Comparing 7024658 FitnessBrowser__ANA3:7024658 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
22% identity, 86% coverage: 28:394/429 of query aligns to 24:374/383 of 5i39A
- active site: F66 (≠ N70), Q69 (= Q73), A70 (≠ V74), Q248 (≠ L271), P267 (≠ D290)
- binding flavin-adenine dinucleotide: V30 (≠ I34), G31 (= G35), G33 (= G37), I34 (≠ F38), L35 (≠ T39), V53 (≠ L57), E54 (= E58), K55 (≠ A59), Q62 (≠ A66), S63 (≠ T67), F66 (≠ N70), Y67 (≠ G71), Q69 (= Q73), A196 (vs. gap), A197 (≠ S210), G226 (= G239), G227 (≠ N240), W229 (≠ Y242), Q248 (≠ L271), Q250 (≠ K273), G321 (= G342), M323 (≠ A344), T348 (≠ S368), G349 (= G369), W350 (≠ H370), G351 (= G371), M352 (≠ V372), T353 (≠ A373)
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
23% identity, 51% coverage: 28:245/429 of query aligns to 16:224/433 of 5hxwA
- active site: F58 (≠ N70), Q61 (= Q73), A62 (≠ V74)
- binding flavin-adenine dinucleotide: V22 (≠ I34), G23 (= G35), G25 (= G37), I26 (≠ F38), L27 (≠ T39), E46 (= E58), K47 (≠ A59), E53 (≠ G65), Q54 (≠ A66), S55 (≠ T67), R57 (= R69), F58 (≠ N70), Y59 (≠ G71), G60 (= G72), Q61 (= Q73), A188 (vs. gap), A189 (≠ S210), G218 (= G239), G219 (≠ N240), W221 (≠ Y242)
Sites not aligning to the query:
- active site: 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320, 373, 379, 399, 400
- binding flavin-adenine dinucleotide: 240, 242, 331, 371, 373, 398, 399, 400, 401, 402, 403
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
27% identity, 29% coverage: 127:250/429 of query aligns to 94:213/364 of 3if9A
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49, 300, 302, 327, 328, 329, 330, 331, 332
- binding glycolic acid: 246, 302, 329
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
27% identity, 29% coverage: 127:250/429 of query aligns to 94:213/369 of O31616
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
- 244 H→A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- 302 binding
- 327:333 binding
- 329 binding
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
27% identity, 29% coverage: 127:250/429 of query aligns to 94:213/364 of 1ng3A
Sites not aligning to the query:
- active site: 47, 48, 49
- binding acetylamino-acetic acid: 246, 302, 329
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49, 300, 302, 327, 329, 330, 331, 332
- binding phosphate ion: 89, 254
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
22% identity, 80% coverage: 44:386/429 of query aligns to 20:351/374 of 1y56B
- active site: F44 (≠ G68), G47 (= G71), T48 (= T75), H224 (≠ N261), P239 (= P277), G305 (= G342), M338 (≠ A373)
- binding flavin-adenine dinucleotide: I33 (≠ L57), E34 (= E58), K35 (≠ A59), S42 (≠ A66), T43 (= T67), R45 (= R69), C46 (≠ N70), G47 (= G71), G49 (= G76), E170 (≠ Q211), V171 (= V212), T200 (≠ G239), N201 (= N240), W203 (≠ Y242), G305 (= G342), Y306 (≠ M343), Y307 (≠ A344), G334 (= G369), H335 (= H370), G336 (= G371), F337 (≠ V372), M338 (≠ A373)
- binding flavin mononucleotide: F44 (≠ G68), R45 (= R69), I260 (≠ D297), R301 (≠ F338), W303 (= W340)
Sites not aligning to the query:
Query Sequence
>7024658 FitnessBrowser__ANA3:7024658
MSAKRCASYYNATIKQESNYPELEGDIRVDVAIIGGGFTGVATAVELAEKGYQVALLEAN
KIAWGATGRNGGQVTGSLSGDAAMTKQLRRQLGQEAEDYVWNLRWRGHDIIKNRVAKYGI
DCDLKFGHIQTAYRPAHMVELQQMFDEANRRGMGELMTLVPAQEMPAYLASPLYHGGLVN
RRNMHLHSVNLCLGEARAAASLGAKIFEHSQVLDIQQGELATVVTPKGRVKANSVLIAGN
AYHKLGRPQLRGMLFPASLGNCATAQLPEDLAKQLNPQDLAVYDCRFVLDYYRLTADNRL
MFGGGTNYSGRDPKNVAAELRPAIERTFPQLKGVDIEFAWAGMAGIVINRIPQLGKIAPN
IFYCQGYSGHGVATSHIMAEIMGQAIDGQMREFDLFASMRHIRIPLNEWFGNQALALGML
YYTLRENWR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory