Comparing 7024890 FitnessBrowser__ANA3:7024890 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
3qdkA Structural insight on mechanism and diverse substrate selection strategy of ribulokinase (see paper)
35% identity, 98% coverage: 8:552/557 of query aligns to 2:530/546 of 3qdkA
3l0qA The crystal structure of xlylulose kinase from yersinia pseudotuberculosis
26% identity, 97% coverage: 7:546/557 of query aligns to 2:530/541 of 3l0qA
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
24% identity, 69% coverage: 163:546/557 of query aligns to 135:477/492 of 3ll3A
Sites not aligning to the query:
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
24% identity, 69% coverage: 163:546/557 of query aligns to 134:475/490 of 3ll3B
Sites not aligning to the query:
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
28% identity, 29% coverage: 388:546/557 of query aligns to 331:486/501 of O34154
Sites not aligning to the query:
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
30% identity, 25% coverage: 407:546/557 of query aligns to 349:485/498 of Q5HGD2
Sites not aligning to the query:
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
30% identity, 25% coverage: 407:546/557 of query aligns to 350:486/499 of 3ge1A
Sites not aligning to the query:
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
21% identity, 75% coverage: 126:540/557 of query aligns to 95:473/478 of 5ya1A
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
21% identity, 75% coverage: 126:540/557 of query aligns to 95:473/478 of 5ya2A
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
26% identity, 27% coverage: 395:546/557 of query aligns to 339:487/506 of O34153
Sites not aligning to the query:
3h3nX Glycerol kinase h232r with glycerol (see paper)
26% identity, 27% coverage: 395:546/557 of query aligns to 338:486/501 of 3h3nX
Sites not aligning to the query:
2w40A Crystal structure of plasmodium falciparum glycerol kinase with bound glycerol (see paper)
24% identity, 22% coverage: 397:521/557 of query aligns to 342:467/501 of 2w40A
Sites not aligning to the query:
2w41B Crystal structure of plasmodium falciparum glycerol kinase with adp (see paper)
24% identity, 22% coverage: 397:521/557 of query aligns to 348:473/507 of 2w41B
Sites not aligning to the query:
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
27% identity, 24% coverage: 411:546/557 of query aligns to 340:470/485 of 6k76A
Sites not aligning to the query:
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
27% identity, 25% coverage: 405:542/557 of query aligns to 346:483/497 of O86033
Sites not aligning to the query:
>7024890 FitnessBrowser__ANA3:7024890
MSNVLGAYALGLDYGSDSVRALLVDTQTGAEVATNVVYYPRWKKGLFCEPAKNQFRQHPL
DYIESLIEVVQGLWAKAPSGAAQRVCGLSVDTTGSTPIAVDESGVALALKPEFENNPNAM
FLLWKDHSAIIEAKQITAAANDSSENYLKYEGGIYSSEWFWAKALFVLRHDAEVRQAAYS
WVEHCDWITALMTGTSHPKVFKAGRCAAGHKVMWHESWNGYPPNDFFVGIDPLLDGLRDK
LPLETCTSDKVCGQLTPEWAQHLGLSTEVIVSFGSFDCHAGAVGANVKPGVLTKVMGTST
CDITVASYEDIGERCIKGICGQVDGSVLPGMIGLEAGQSAFGDLYAWFRDLTAWPMQQLD
TSVLFDENIKAKLIQQLESETLTMLGNAAAKIPVGETGIVALDWINGRRTPDADQSVAMA
ITGLTMGSQAPQVFKALVEASAYGARAIIERFKQEGVCIDHVVTIGGISKKSDFIMQTCA
DVWNCNIDVLESEQSCALGAAIYAATAAGVYPDVLSAQAAMASNVAKTYQPNPENAEKYQ
ALYQGYLALGHYVDGAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory