SitesBLAST
Comparing 7024897 FitnessBrowser__ANA3:7024897 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5wjsA Crystal structure of oxidoreductase (short chain dehydrogenase/reductase family) from burkholderia thailandensis complexed with nadh
51% identity, 98% coverage: 6:255/256 of query aligns to 10:257/258 of 5wjsA
- active site: G27 (= G23), S152 (= S150), Y162 (≠ M160), Y165 (= Y163), K169 (= K167)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G23 (= G19), T26 (= T22), I28 (= I24), D47 (= D43), L48 (≠ I44), D73 (= D71), L74 (= L72), N100 (= N98), A102 (= A100), L150 (= L148), G151 (= G149), S152 (= S150), K169 (= K167), P195 (= P193), G196 (= G194), W197 (= W195), V198 (= V196), K202 (≠ R200)
7wwxA Crystal structure of herbaspirillum huttiense l-arabinose 1- dehydrogenase (NAD bound form) (see paper)
54% identity, 100% coverage: 1:256/256 of query aligns to 1:254/254 of 7wwxA
- binding nicotinamide-adenine-dinucleotide: G18 (= G19), T21 (= T22), I23 (= I24), D42 (= D43), I43 (= I44), C68 (= C70), D69 (= D71), L70 (= L72), N96 (= N98), A98 (= A100), F146 (≠ L148), S147 (≠ G149), S148 (= S150), Y161 (= Y163), K165 (= K167), P191 (= P193), G192 (= G194), W193 (= W195), V194 (= V196), R198 (= R200)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
33% identity, 96% coverage: 10:254/256 of query aligns to 3:236/239 of 4nbtA
- active site: G16 (= G23), S132 (= S150), Y145 (= Y163), K149 (= K167)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), K15 (≠ T22), G16 (= G23), L17 (≠ I24), D36 (= D43), L37 (≠ I44), L52 (≠ C70), N53 (≠ D71), V54 (≠ L72), N80 (= N98), A81 (= A99), G82 (≠ A100), I130 (≠ L148), S132 (= S150), Y145 (= Y163), K149 (= K167), P177 (= P193), G178 (= G194), I180 (≠ V196), T182 (= T198)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
32% identity, 96% coverage: 10:256/256 of query aligns to 4:238/244 of 1nfqA
- active site: G17 (= G23), S139 (= S150), Y152 (= Y163), K156 (= K167)
- binding Androsterone: L91 (≠ D102), E141 (≠ S152), C149 (≠ M160), Y152 (= Y163), V193 (= V206), I197 (≠ T210), F198 (≠ A211)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ T22), G17 (= G23), M18 (≠ I24), D37 (= D43), L39 (= L45), L59 (≠ C70), D60 (= D71), V61 (≠ L72), N87 (= N98), A88 (= A99), I137 (≠ L148), S139 (= S150), Y152 (= Y163), K156 (= K167), P182 (= P193), V185 (= V196), T187 (≠ R200), P188 (≠ Q201), M189 (≠ L202), T190 (= T203)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
32% identity, 96% coverage: 10:256/256 of query aligns to 4:238/244 of 1nffA
- active site: G17 (= G23), S139 (= S150), Y152 (= Y163), K156 (= K167)
- binding nicotinamide-adenine-dinucleotide: G13 (= G19), R16 (≠ T22), G17 (= G23), M18 (≠ I24), D37 (= D43), I38 (= I44), L39 (= L45), L59 (≠ C70), D60 (= D71), V61 (≠ L72), N87 (= N98), A88 (= A99), G89 (≠ A100), I90 (≠ C101), I137 (≠ L148), S139 (= S150), Y152 (= Y163), K156 (= K167), P182 (= P193), V185 (= V196), T187 (≠ R200), P188 (≠ Q201), M189 (≠ L202), T190 (= T203)
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
33% identity, 96% coverage: 9:255/256 of query aligns to 2:245/247 of 6j7uA
- active site: G16 (= G23), S142 (= S150), Y156 (= Y163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G19), S14 (≠ A21), R15 (≠ T22), I17 (= I24), Y36 (≠ D43), V37 (≠ I44), S38 (≠ L45), S41 (≠ E48), D65 (= D71), S66 (≠ L72), N92 (= N98), A93 (= A99), G94 (≠ A100), I115 (≠ T121), G141 (= G149), S142 (= S150), Y156 (= Y163), K160 (= K167), P186 (= P193), T191 (= T198), M193 (≠ T203), N194 (≠ H204)
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 96% coverage: 10:256/256 of query aligns to 5:239/260 of P9WGT1
- I6 (≠ Q11) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ TGI 22:24) binding NAD(+)
- D38 (= D43) binding NAD(+)
- V47 (≠ K57) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (≠ DL 71:72) binding NAD(+)
- T69 (≠ K79) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (= N98) binding NAD(+)
- S140 (= S150) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y163) binding NAD(+); mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K167) binding NAD(+)
- 183:191 (vs. 193:203, 45% identical) binding NAD(+)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
26% identity, 96% coverage: 10:255/256 of query aligns to 4:249/252 of 1vl8B
- active site: G17 (= G23), S143 (= S150), I154 (≠ M160), Y157 (= Y163), K161 (= K167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G19), R16 (≠ T22), G17 (= G23), L18 (≠ I24), S37 (≠ D43), R38 (≠ I44), C63 (= C70), D64 (= D71), V65 (≠ L72), A91 (≠ N98), A92 (= A99), G93 (≠ A100), I94 (≠ C101), V114 (≠ T121), I141 (≠ L148), S143 (= S150), Y157 (= Y163), K161 (= K167), P187 (= P193), G188 (= G194), Y190 (≠ V196), T192 (= T198), M194 (≠ R200), T195 (≠ Q201)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
31% identity, 96% coverage: 10:254/256 of query aligns to 5:241/244 of 4nbuB
- active site: G18 (= G23), N111 (= N122), S139 (= S150), Q149 (≠ M160), Y152 (= Y163), K156 (= K167)
- binding acetoacetyl-coenzyme a: D93 (≠ R104), K98 (≠ E109), S139 (= S150), N146 (≠ Q157), V147 (≠ A158), Q149 (≠ M160), Y152 (= Y163), F184 (≠ W195), M189 (≠ L202), K200 (≠ H213)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G19), N17 (≠ T22), G18 (= G23), I19 (= I24), D38 (= D43), F39 (≠ I44), V59 (≠ C70), D60 (= D71), V61 (≠ L72), N87 (= N98), A88 (= A99), G89 (≠ A100), I90 (≠ C101), T137 (≠ L148), S139 (= S150), Y152 (= Y163), K156 (= K167), P182 (= P193), F184 (≠ W195), T185 (= T198), T187 (≠ R200), M189 (≠ L202)
F1SWA0 Zerumbone synthase; EC 1.1.1.326 from Zingiber zerumbet (Shampoo ginger) (Amomum zerumbet) (see paper)
30% identity, 96% coverage: 10:255/256 of query aligns to 3:256/267 of F1SWA0
- S142 (= S150) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- S144 (= S152) mutation to A: Increased oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- Y155 (= Y163) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- K159 (= K167) mutation to A: Abolishes all oxidoreductase activity.
Q9BTZ2 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; NADPH-dependent retinol dehydrogenase/reductase; NRDR; humNRDR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; SCAD-SRL; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; Short-chain dehydrogenase/reductase family member 4; EC 1.1.1.184 from Homo sapiens (Human) (see 2 papers)
31% identity, 98% coverage: 3:254/256 of query aligns to 24:273/278 of Q9BTZ2
- S176 (≠ Q157) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to F: Decreased reduction activity for benzil, isatin and retinal and increased activity for 5beta-Pregnane-3,20-dione and 5beta-Dihydrotestosterone. No change of stereoselectivity in 3-ketosteroids reduction and no change in 3beta-hydroxysteroid oxidation. Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with L-179. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with L-179. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with L-179. Loss of cold catalytic inactivation; when associated with L-179 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with L-179 and N-195.
- F179 (≠ M160) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to L: Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with F-176. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with F-176. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176. Loss of cold catalytic inactivation; when associated with F-176 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and N-195.
- T195 (≠ G176) mutation to N: Loss of cold catalytic inactivation. Loss of cold catalytic inactivation; when associated with F-176 and L-179. Switch in stereoselective activity from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176 and L-179. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and L-179.
7krmC Putative fabg bound to nadh from acinetobacter baumannii
35% identity, 96% coverage: 10:256/256 of query aligns to 3:242/244 of 7krmC
- active site: G18 (= G23), S140 (= S150), Y155 (= Y163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), S15 (≠ T22), G18 (= G23), I19 (= I24), D38 (= D43), L39 (≠ I44), A60 (vs. gap), N61 (≠ D74), V62 (≠ I75), N88 (= N98), V111 (≠ T121), S140 (= S150), Y155 (= Y163), K159 (= K167), I188 (≠ V196), T190 (= T198)
3o4rA Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
31% identity, 96% coverage: 10:254/256 of query aligns to 6:249/254 of 3o4rA
- active site: G19 (= G23), S145 (= S150), F155 (≠ M160), Y158 (= Y163), K162 (= K167), K203 (= K208)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A15 (≠ G19), T17 (≠ A21), D18 (≠ T22), G19 (= G23), I20 (= I24), S39 (≠ D43), R40 (≠ I44), K41 (≠ L45), N44 (≠ E48), H65 (≠ D71), V66 (≠ L72), N92 (= N98), A94 (= A100), S145 (= S150), Y158 (= Y163), K162 (= K167), P188 (= P193), G189 (= G194), L190 (≠ W195), I191 (≠ V196), T193 (= T198), F195 (≠ R200), S196 (≠ Q201)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
31% identity, 97% coverage: 9:256/256 of query aligns to 2:246/247 of 4jroC
- active site: G16 (= G23), S142 (= S150), Q152 (≠ M160), Y155 (= Y163), K159 (= K167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G19), S14 (≠ A21), R15 (≠ T22), G16 (= G23), I17 (= I24), N35 (vs. gap), Y36 (vs. gap), N37 (vs. gap), G38 (vs. gap), S39 (≠ V42), N63 (≠ V81), V64 (≠ I82), N90 (= N98), A91 (= A99), I93 (≠ C101), I113 (≠ T121), S142 (= S150), Y155 (= Y163), K159 (= K167), P185 (= P193), I188 (≠ V196), T190 (= T198)
2ewmB Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 (see paper)
31% identity, 96% coverage: 10:256/256 of query aligns to 3:245/247 of 2ewmB
- active site: G16 (= G23), S139 (= S150), Y149 (≠ M160), Y152 (= Y163), K156 (= K167)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), N15 (≠ T22), G16 (= G23), I17 (= I24), D36 (= D43), L37 (≠ I44), C59 (= C70), D60 (= D71), V61 (≠ L72), N87 (= N98), S139 (= S150), Y152 (= Y163), K156 (= K167), P182 (= P193), S183 (≠ G194), L184 (≠ W195), V185 (= V196), T189 (≠ R200)
Q5P5I4 (S)-1-Phenylethanol dehydrogenase; EC 1.1.1.311 from Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) (see 2 papers)
31% identity, 96% coverage: 10:256/256 of query aligns to 5:247/249 of Q5P5I4
- NGI 17:19 (≠ TGI 22:24) binding NAD(+)
- D38 (= D43) binding NAD(+)
- CDV 61:63 (≠ CDL 70:72) binding NAD(+)
- N89 (= N98) binding NAD(+)
- Y93 (≠ D102) binding NAD(+)
- K158 (= K167) binding NAD(+)
- PSLV 184:187 (≠ PGWV 193:196) binding NAD(+)
- T191 (≠ R200) binding NAD(+)
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
31% identity, 95% coverage: 12:254/256 of query aligns to 5:235/240 of 2d1yA
- active site: G16 (= G23), S135 (= S150), N145 (≠ M160), Y148 (= Y163), K152 (= K167)
- binding nicotinamide-adenine-dinucleotide: G12 (= G19), R15 (≠ T22), I17 (= I24), D36 (= D43), L37 (≠ I44), R38 (≠ L45), V55 (≠ C70), D56 (= D71), L57 (= L72), N83 (= N98), A84 (= A99), A85 (= A100), I86 (≠ C101), V133 (≠ L148), S135 (= S150), Y148 (= Y163), K152 (= K167), P178 (= P193), G179 (= G194), I181 (≠ V196), T183 (= T198), A185 (≠ R200), V186 (≠ Q201)
2zatA Crystal structure of a mammalian reductase (see paper)
30% identity, 96% coverage: 10:254/256 of query aligns to 3:246/251 of 2zatA
- active site: G16 (= G23), S142 (= S150), L152 (≠ M160), Y155 (= Y163), K159 (= K167), K200 (= K208)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A12 (≠ G19), T14 (≠ A21), D15 (≠ T22), G16 (= G23), I17 (= I24), S36 (≠ D43), R37 (≠ I44), K38 (≠ L45), N41 (≠ E48), H62 (≠ D71), N89 (= N98), A91 (= A100), V140 (≠ L148), S142 (= S150), Y155 (= Y163), K159 (= K167), P185 (= P193), G186 (= G194), I188 (≠ V196), T190 (= T198), F192 (≠ R200), S193 (≠ Q201)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
29% identity, 96% coverage: 10:255/256 of query aligns to 4:257/260 of 6zzqA
- active site: G17 (= G23), S142 (= S150), Y155 (= Y163)
- binding acetoacetic acid: Q94 (≠ D102), S142 (= S150), K152 (≠ M160), Y155 (= Y163), Q196 (≠ H204)
- binding nicotinamide-adenine-dinucleotide: G13 (= G19), S16 (≠ T22), G17 (= G23), I18 (= I24), D37 (= D43), M38 (≠ I44), D63 (= D71), V64 (≠ L72), N90 (= N98), A91 (= A99), G92 (≠ A100), M140 (≠ L148), A141 (≠ G149), S142 (= S150), Y155 (= Y163), K159 (= K167), Y187 (≠ W195), V188 (= V196), T190 (= T198)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
29% identity, 96% coverage: 10:255/256 of query aligns to 5:258/261 of 6zzsD
- active site: G18 (= G23), S143 (= S150), Y156 (= Y163)
- binding nicotinamide-adenine-dinucleotide: G14 (= G19), S17 (≠ T22), I19 (= I24), D38 (= D43), M39 (≠ I44), D64 (= D71), V65 (≠ L72), N91 (= N98), A92 (= A99), G93 (≠ A100), M141 (≠ L148), A142 (≠ G149), S143 (= S150), Y156 (= Y163), K160 (= K167), P186 (= P193), G187 (= G194), V189 (= V196), T191 (= T198), L193 (≠ R200)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ D102), S143 (= S150), N145 (≠ S152), K153 (≠ M160), Y156 (= Y163), Q197 (≠ H204)
Query Sequence
>7024897 FitnessBrowser__ANA3:7024897
MKLTNQYPSLQGKTIFISGGATGIGACLVNAFLEQGAKVAFVDILVEESTQLVADLKQTQ
PEASVTFYHCDLVDIAALKRVIAQVEDDLGPISVLINNAACDQRHSIDEVTPEYWDQCLN
TNLRHYFFAVQAVRPQMQRLGGGSVINLGSMSWHNRQAGMAGYTASKAGAMGLTRGLAAD
LGKDKIRINTLTPGWVMTKRQLTHWVDKDTAKHIENNQCIKEYVMPEDIAAMALFLAADD
SKLCTAQNFIVDGGWI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory