Comparing 7024899 FitnessBrowser__ANA3:7024899 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
100% identity, 93% coverage: 23:313/313 of query aligns to 1:291/302 of 5ocpA
P39325 Galactofuranose-binding protein YtfQ from Escherichia coli (strain K12) (see 2 papers)
58% identity, 98% coverage: 6:312/313 of query aligns to 7:315/318 of P39325
Sites not aligning to the query:
2vk2A Crystal structure of a galactofuranose binding protein (see paper)
60% identity, 92% coverage: 24:312/313 of query aligns to 3:293/296 of 2vk2A
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
47% identity, 93% coverage: 22:311/313 of query aligns to 2:291/305 of 6hbdA
Sites not aligning to the query:
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
47% identity, 93% coverage: 22:311/313 of query aligns to 1:290/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
47% identity, 93% coverage: 22:311/313 of query aligns to 1:290/304 of 6hbmA
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
35% identity, 84% coverage: 24:285/313 of query aligns to 2:256/274 of 2ioyA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
33% identity, 89% coverage: 15:292/313 of query aligns to 1:269/284 of 7e7mC
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
33% identity, 81% coverage: 36:289/313 of query aligns to 15:260/271 of 1dbpA
Sites not aligning to the query:
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
33% identity, 85% coverage: 36:302/313 of query aligns to 15:282/292 of 2fn8A
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
33% identity, 80% coverage: 34:283/313 of query aligns to 45:288/349 of A0QYB3
Sites not aligning to the query:
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
33% identity, 80% coverage: 34:283/313 of query aligns to 12:255/314 of 5hkoA
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
33% identity, 80% coverage: 34:283/313 of query aligns to 12:255/315 of 4rs3A
Sites not aligning to the query:
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
30% identity, 72% coverage: 25:248/313 of query aligns to 4:220/301 of 2x7xA
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
31% identity, 81% coverage: 36:290/313 of query aligns to 16:261/270 of 4zjpA
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 84% coverage: 8:269/313 of query aligns to 14:279/349 of A0QYB5
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
33% identity, 75% coverage: 34:269/313 of query aligns to 13:247/315 of 4rsmA
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
31% identity, 73% coverage: 36:263/313 of query aligns to 19:241/287 of 4yo7A
Sites not aligning to the query:
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
27% identity, 78% coverage: 25:267/313 of query aligns to 5:243/288 of 4rxmB
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
27% identity, 78% coverage: 25:267/313 of query aligns to 7:245/291 of 4rxmA
Sites not aligning to the query:
>7024899 FitnessBrowser__ANA3:7024899
MKHNKIITALGLWAVSATCAYATTVGFSQVGSESGWRTSFSEAVKAEAKQRGIDLKFADA
QQKQENQIKAVRSFIAQGVDAIIIAPVVETGWKPVLKEAKRAKIPVVIVDRNIKVDDDSL
FLTRIASDFSEEGRKIGQWLMDKTQGNCDIAELQGTVGATAAIDRAAGFNQVIANYPNAK
IVRSQTGEFTRAKGKEVMEGFLKAQNGQPLCAVWSHNDEMALGAVQAIKEAGLKPGKDIL
IVSVDGVPDYFKAMADGDVNATVELSPYLGGPAFDAIDAYLKGNKDQAKLISTTGDVFTQ
ETAAAEYEKRRQQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory