Comparing 7024900 FitnessBrowser__ANA3:7024900 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
38% identity, 100% coverage: 1:499/499 of query aligns to 1:493/501 of P04983
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 47% coverage: 4:238/499 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 47% coverage: 4:239/499 of query aligns to 4:254/254 of 1g6hA
3c4jA Abc protein artp in complex with atp-gamma-s
27% identity, 47% coverage: 4:239/499 of query aligns to 3:240/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
27% identity, 47% coverage: 4:239/499 of query aligns to 3:240/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
27% identity, 47% coverage: 4:239/499 of query aligns to 3:240/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
27% identity, 47% coverage: 4:239/499 of query aligns to 3:240/242 of 2oljA
5x40A Structure of a cbio dimer bound with amppcp (see paper)
32% identity, 44% coverage: 1:221/499 of query aligns to 1:221/280 of 5x40A
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
25% identity, 48% coverage: 4:242/499 of query aligns to 2:241/241 of 4u00A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 43% coverage: 1:217/499 of query aligns to 14:225/378 of P69874
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
29% identity, 43% coverage: 4:219/499 of query aligns to 1:207/348 of 3d31A
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
27% identity, 44% coverage: 10:227/499 of query aligns to 7:223/240 of 4ymuJ
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
29% identity, 45% coverage: 3:227/499 of query aligns to 4:227/233 of P75957
7mdyC Lolcde nucleotide-bound
29% identity, 45% coverage: 3:227/499 of query aligns to 1:224/226 of 7mdyC
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
28% identity, 44% coverage: 1:219/499 of query aligns to 1:222/648 of P75831
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
28% identity, 45% coverage: 3:227/499 of query aligns to 3:226/229 of 7v8iD
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 47% coverage: 17:251/499 of query aligns to 18:256/343 of P30750
Sites not aligning to the query:
7arlD Lolcde in complex with lipoprotein and adp (see paper)
27% identity, 43% coverage: 3:218/499 of query aligns to 1:220/222 of 7arlD
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
28% identity, 47% coverage: 17:251/499 of query aligns to 19:257/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
28% identity, 47% coverage: 17:251/499 of query aligns to 19:257/344 of 3tuzC
Sites not aligning to the query:
>7024900 FitnessBrowser__ANA3:7024900
MSLILELKQISKHYPGVKALEDVSLRLFAGEVHALLGENGAGKSTLVKVMTGAQSKDMGD
ILFLGEPQHFNTPMDAQKAGISTVYQEVNLVPNLTVAQNLFLGYEPRRLGLIHFKKMYAD
ARAVLTQFKLDIDVSAPLSDYSIAVQQLIAIARGVAMSAKVLVLDEPTASLDAKEVQVLF
GILNQLKAKGVAIVFITHFLDQVYQISDRITVLRNGQFIGEYLTAELPQPKLIEAMLGRS
LQEQLVDKQEKERTVTRAEAVLLSLEDVSVKGSIQSMNLTVPKGQAVGLAGLLGSGRSEV
CNAVFGLDLVDSGSIHLAGQKLNLSQPVDAISAGIALCPEDRKIDGIIGPLSIRENIILA
LQARIGWWRYLSNTRQQEIAQFFIDKLQIATPDADKPIEQLSGGNQQKVILARWLAIEPI
LLVLDEPTRGIDIGAHAEIVKLIRTLCDEGMSLLVASSELDELVAFSNKVVVLRDRYAVR
ELSGAELTSQHVMQAIAEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory