Comparing 7024977 FitnessBrowser__ANA3:7024977 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
1euaA Schiff base intermediate in kdpg aldolase from escherichia coli (see paper)
61% identity, 98% coverage: 4:212/213 of query aligns to 2:210/213 of 1euaA
P0A955 KHG/KDPG aldolase; EC 4.1.3.16; EC 4.1.2.14 from Escherichia coli (strain K12) (see 3 papers)
61% identity, 98% coverage: 4:212/213 of query aligns to 2:210/213 of P0A955
1wauA Structure of kdpg aldolase e45n mutant (see paper)
60% identity, 98% coverage: 4:212/213 of query aligns to 2:210/213 of 1wauA
2c0aB Mechanism of the class i kdpg aldolase (see paper)
60% identity, 98% coverage: 4:212/213 of query aligns to 3:211/214 of 2c0aB
Sites not aligning to the query:
6oviA Crystal structure of kdpg aldolase from legionella pneumophila with pyruvate captured at low ph as a covalent carbinolamine intermediate
54% identity, 94% coverage: 6:206/213 of query aligns to 1:201/210 of 6oviA
1mxsA Crystal structure of 2-keto-3-deoxy-6-phosphogluconate (kdpg) aldolase from pseudomonas putida. (see paper)
50% identity, 93% coverage: 13:210/213 of query aligns to 13:210/216 of 1mxsA
P00885 2-dehydro-3-deoxy-phosphogluconate aldolase; KDPG-aldolase; Phospho-2-dehydro-3-deoxygluconate aldolase; Phospho-2-keto-3-deoxygluconate aldolase; EC 4.1.2.14 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
50% identity, 93% coverage: 13:210/213 of query aligns to 23:220/226 of P00885
Sites not aligning to the query:
5xsfA Crystal structure of the 2-keto-3-deoxy-6-phosphogluconate aldolase of zymomonas mobilis zm4 with 3-phosphoglycerate
51% identity, 93% coverage: 11:209/213 of query aligns to 6:200/209 of 5xsfA
3vcrA Crystal structure of a putative kdpg (2-keto-3-deoxy-6- phosphogluconate) aldolase from oleispira antarctica (see paper)
49% identity, 91% coverage: 17:210/213 of query aligns to 12:211/216 of 3vcrA
1wa3D Mechanism of the class i kdpg aldolase (see paper)
35% identity, 74% coverage: 11:167/213 of query aligns to 3:159/203 of 1wa3D
Sites not aligning to the query:
Q6BF16 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; 2-oxo-3-deoxygalactonate 6-phosphate aldolase; 6-phospho-2-dehydro-3-deoxygalactonate aldolase; 6-phospho-2-keto-3-deoxygalactonate aldolase; KDPGal; EC 4.1.2.21 from Escherichia coli (strain K12) (see paper)
27% identity, 75% coverage: 16:175/213 of query aligns to 6:166/205 of Q6BF16
2v82A Kdpgal complexed to kdpgal (see paper)
27% identity, 75% coverage: 16:175/213 of query aligns to 5:165/205 of 2v82A
Sites not aligning to the query:
>7024977 FitnessBrowser__ANA3:7024977
MLENNWSLQPQDIFKRSPIVPVMVINKIEHAVPLAKALVAGGISVLEVTLRTPCALDAIT
KIAQEVPEALVGAGTILNEAQLDQAIAAGAQFIITPGATVELLKAGMQGPVPLIPGVASI
SEVMTGMALGYTHFKFFPAEASGGVDALKAFSGPLADIRFCPTGGITPSSYKDYLALKNV
DCIGGSWIAPTDAMEQGDWARITQLCKDAIGGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory