Comparing 7025095 FitnessBrowser__ANA3:7025095 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P69783 PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component from Escherichia coli (strain K12) (see 6 papers)
60% identity, 99% coverage: 1:168/169 of query aligns to 1:168/169 of P69783
1glcF Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
59% identity, 99% coverage: 2:168/169 of query aligns to 1:160/161 of 1glcF
1o2fA Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
64% identity, 88% coverage: 21:168/169 of query aligns to 2:149/150 of 1o2fA
P09323 PTS system N-acetylglucosamine-specific EIICBA component; EIICBA-Nag; EII-Nag; EC 2.7.1.193 from Escherichia coli (strain K12) (see paper)
47% identity, 85% coverage: 25:168/169 of query aligns to 503:647/648 of P09323
Sites not aligning to the query:
>7025095 FitnessBrowser__ANA3:7025095
MGFLSRIRRLVSGQPQLAGGIMVYAPVNGEIVAIEKVPDVVFAEKIVGDGIAIAPKGDTI
VAPIDGTIGKIFETNHAFSIESPQGLELFVHFGVGTVELRGRGFSRLAEEGQEVKVGDPI
LSFDIDYLKDQVDSLLTPVVLANMEDVKYLDKAQGSVTAGKDAIFTVQL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory