Comparing 7025139 FitnessBrowser__ANA3:7025139 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
E9AE57 Fumarate hydratase 2; Fumarase 2; LmFH-2; EC 4.2.1.2 from Leishmania major (see paper)
31% identity, 91% coverage: 25:494/514 of query aligns to 82:559/568 of E9AE57
6uoiA Crystal structure of cytosolic fumarate hydratase from leishmania major in a complex with malonate (see paper)
31% identity, 91% coverage: 25:494/514 of query aligns to 57:526/535 of 6uoiA
6unzA Crystal structure of cytosolic fumarate hydratase from leishmania major (see paper)
31% identity, 91% coverage: 25:494/514 of query aligns to 62:530/539 of 6unzA
6msnA Crystal structure of cytosolic fumarate hydratase from leishmania major in a complex with inhibitor thiomalate (see paper)
31% identity, 91% coverage: 25:494/514 of query aligns to 55:523/532 of 6msnA
6uqnB Crystal structure of r173a variant of cytosolic fumarate hydratase from leishmania major in a complex with fumarate and s-malate (see paper)
30% identity, 91% coverage: 25:494/514 of query aligns to 55:523/532 of 6uqnB
P14407 Fumarate hydratase class I, anaerobic; D-tartrate dehydratase; Fumarase B; EC 4.2.1.2; EC 4.2.1.81 from Escherichia coli (strain K12) (see paper)
32% identity, 88% coverage: 45:494/514 of query aligns to 75:531/548 of P14407
6msoA Crystal structure of mitochondrial fumarate hydratase from leishmania major in a complex with inhibitor thiomalate (see paper)
29% identity, 88% coverage: 48:499/514 of query aligns to 78:538/540 of 6msoA
Q4QAU9 Fumarate hydratase 1, mitochondrial; Fumarase 1; LmFH-1; EC 4.2.1.2 from Leishmania major (see paper)
29% identity, 88% coverage: 48:499/514 of query aligns to 87:547/549 of Q4QAU9
>7025139 FitnessBrowser__ANA3:7025139
MSSHHETSENVVIKQADFIESVADALQYISYYHPKDFVDAMSEAYEREQSAAAKDAIAQI
LINSRMSAEGKRPLCQDTGIVTTFVKIGMGVKWDKTDMTVQQMVDEGVRRAYTNPDNPLR
ASIVADPAGSRKNTKDNTPSVVHIDMVPGNHIEVAIAAKGGGSENKAKMVMLNPSDDIAA
WVEKTLPTMGAGWCPPGMLGIGIGGTAEKAAVLAKEALMESVDIHELMARGAETSEEKLR
LDIFERANNLGIGAQGLGGLTTVLDVKIKSAPTHAASKPVVMIPNCAATRHVHFHLDGSG
PADLAPPTLSDWPEITREVGSDVRRVNLDTVTQADIEQWKSGETILLSGKMLTGRDAAHK
RIQSLIESGEGLPEGVDFTGKFIYYVGPVDPVGNEVVGPAGPTTATRMDKFTDLMLDKTG
LMGMIGKAERGPATVESIKKHKAVYLMAVGGAAYLVSKAIKKSRVVAFADLGMEAIYEFD
VQDMPVTVAVDSNGVNAHETGPAIWKVNIANAKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory