SitesBLAST
Comparing 7025140 FitnessBrowser__ANA3:7025140 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P05041 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Escherichia coli (strain K12) (see 4 papers)
55% identity, 97% coverage: 10:464/467 of query aligns to 7:452/453 of P05041
- S36 (= S38) binding
- E258 (= E270) mutation to A: The reaction is extremely slow.; mutation to D: The reaction is extremely slow.
- K274 (= K286) mutation to A: Absence of covalent intermediate. Addition of ammonia allows the formation of the covalent intermediate and shows that ammonia can replace the function of K-274. Reduced catalytic efficiency.; mutation to R: Absence of covalent intermediate.; mutation to R: Reduced catalytic efficiency.
- G275 (= G287) mutation to S: Catalytically inactive for both the glutamine-dependent and ammonia-dependent reactions and fails to interact with PabA.
- R311 (= R323) mutation to K: Catalytically active in the NH3-dependent, but inactive for the glutamine-dependent reactions and fails to complex with PabA.
- R316 (≠ K328) mutation to H: Catalytically inactive for both the glutamine-dependent and ammonia-dependent reactions and fails to interact with PabA.
- S322 (≠ T334) mutation to T: Complete loss of aminodeoxychorismate synthase activity.
- H339 (= H351) mutation to W: Catalytically inactive for both the glutamine-dependent and ammonia-dependent reactions and fails to interact with PabA.
1k0eA The crystal structure of aminodeoxychorismate synthase from formate grown crystals (see paper)
54% identity, 97% coverage: 10:464/467 of query aligns to 5:436/437 of 1k0eA
- active site: E256 (= E270), K272 (= K286), E286 (= E314), H323 (= H351), S350 (= S378), W374 (≠ Y402), R394 (= R422), G410 (= G438), E423 (= E451), K427 (= K455)
- binding tryptophan: L32 (= L36), H33 (≠ D37), S34 (= S38), Y41 (≠ D45), F44 (= F48), P238 (= P252), F239 (= F253), S240 (= S254)
1k0gA The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
50% identity, 97% coverage: 10:464/467 of query aligns to 7:419/420 of 1k0gA
- active site: E258 (= E270), K274 (= K286), E278 (= E314), S333 (= S378), W357 (≠ Y402), R377 (= R422), G393 (= G438), E406 (= E451), K410 (= K455)
- binding phosphate ion: D113 (= D120), R116 (= R123), D347 (≠ E392), R353 (= R398)
- binding tryptophan: L34 (= L36), H35 (≠ D37), S36 (= S38), Y43 (≠ D45), S44 (≠ A46), F46 (= F48), P240 (= P252), F241 (= F253), S242 (= S254)
1k0gB The crystal structure of aminodeoxychorismate synthase from phosphate grown crystals (see paper)
50% identity, 97% coverage: 10:463/467 of query aligns to 7:415/415 of 1k0gB
- active site: E258 (= E270), K274 (= K286), E277 (= E314), S330 (= S378), W354 (≠ Y402), R374 (= R422), G390 (= G438), E403 (= E451), K407 (= K455)
- binding phosphate ion: Y112 (= Y119), D113 (= D120), R116 (= R123), D344 (≠ E392), R350 (= R398)
- binding tryptophan: L34 (= L36), H35 (≠ D37), S36 (= S38), Y43 (≠ D45), S44 (≠ A46), R45 (≠ K47), F46 (= F48), P240 (= P252), F241 (= F253)
7pi1DDD Aminodeoxychorismate synthase component 1
34% identity, 90% coverage: 34:455/467 of query aligns to 31:445/459 of 7pi1DDD
- binding magnesium ion: G428 (= G438), E438 (= E448)
- binding tryptophan: L33 (= L36), E34 (≠ D37), S35 (= S38), G39 (≠ A46), Y41 (≠ F48), P242 (= P252), Y243 (≠ F253), M244 (≠ S254), Q406 (≠ D416), N408 (≠ S418)
P28820 Aminodeoxychorismate synthase component 1; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 1; EC 2.6.1.85 from Bacillus subtilis (strain 168) (see paper)
34% identity, 90% coverage: 34:455/467 of query aligns to 33:452/470 of P28820
- A283 (≠ K286) mutation to I: Complete loss of aminodeoxychorismate synthase activity.; mutation to K: Absence of covalent intermediate.; mutation to V: Complete loss of aminodeoxychorismate synthase activity.
P32068 Anthranilate synthase alpha subunit 1, chloroplastic; Anthranilate synthase component 1-1; Anthranilate synthase component I-1; Protein A-METHYL TRYPTOPHAN RESISTANT 1; Protein JASMONATE-INDUCED DEFECTIVE LATERAL ROOT 1; Protein TRYPTOPHAN BIOSYNTHESIS 5; Protein WEAK ETHYLENE INSENSITIVE 2; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 90% coverage: 46:465/467 of query aligns to 126:590/595 of P32068
- D341 (= D237) mutation to N: In trp5-1; insensitive to feedback inhibition by tryptophan and resistance to the herbicide 6-methylanthranilate.
7bvdA Anthranilate synthase component i (trpe)[mycolicibacterium smegmatis]
33% identity, 82% coverage: 76:460/467 of query aligns to 86:487/499 of 7bvdA
- active site: Q248 (= Q223), E301 (= E270), A317 (≠ K286), E341 (= E314), H378 (= H351), T405 (≠ S378), Y429 (= Y402), R449 (= R422), G465 (= G438), E478 (= E451), K482 (= K455)
- binding pyruvic acid: S93 (≠ P83), G94 (≠ Q84), A100 (≠ L90)
Q94GF1 Anthranilate synthase alpha subunit 1, chloroplastic; OsASA1; EC 4.1.3.27 from Oryza sativa subsp. japonica (Rice) (see paper)
30% identity, 90% coverage: 46:465/467 of query aligns to 110:572/577 of Q94GF1
- D323 (= D237) mutation to N: Insensitive to feedback inhibition by tryptophan.
A0QX93 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
32% identity, 93% coverage: 28:460/467 of query aligns to 64:512/524 of A0QX93
- K355 (≠ Q303) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
35% identity, 81% coverage: 90:465/467 of query aligns to 286:672/673 of 8hx8A
Sites not aligning to the query:
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
41% identity, 57% coverage: 198:464/467 of query aligns to 365:632/632 of 8hx9A
- binding (3R,4R)-3-[(1-carboxyethenyl)oxy]-4-hydroxycyclohexa-1,5-diene-1-carboxylic acid: I453 (= I285), K454 (= K286), G455 (= G287), T456 (= T288), M547 (≠ I379), Y570 (= Y402), R590 (= R422), V603 (≠ A435), G604 (= G436), G605 (= G437), A606 (≠ G438), E619 (= E451), K623 (= K455)
- binding tryptophan: P419 (= P252), Y420 (≠ F253), G421 (≠ S254), L574 (≠ M406), G575 (= G407)
Sites not aligning to the query:
5cwaA Structure of anthranilate synthase component i (trpe) from mycobacterium tuberculosis with inhibitor bound (see paper)
32% identity, 93% coverage: 28:460/467 of query aligns to 44:491/505 of 5cwaA
- active site: Q248 (= Q223), E301 (= E270), A317 (≠ K286), E345 (= E314), H382 (= H351), T409 (≠ S378), Y433 (= Y402), R453 (= R422), G469 (= G438), E482 (= E451), K486 (= K455)
- binding 3-{[(1Z)-1-carboxyprop-1-en-1-yl]oxy}-2-hydroxybenzoic acid: Y433 (= Y402), I452 (= I421), A466 (= A435), G467 (= G436), K486 (= K455)
O94582 Probable anthranilate synthase component 1; Anthranilate synthase component I; EC 4.1.3.27 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 75% coverage: 109:456/467 of query aligns to 104:467/489 of O94582
- S390 (≠ T380) modified: Phosphoserine
- S392 (≠ A382) modified: Phosphoserine
Sites not aligning to the query:
- 488 modified: Phosphoserine
1i1qA Structure of the cooperative allosteric anthranilate synthase from salmonella typhimurium (see paper)
29% identity, 74% coverage: 115:460/467 of query aligns to 144:503/512 of 1i1qA
- active site: Q259 (= Q223), E305 (= E270), A323 (≠ K286), E357 (= E314), H394 (= H351), T421 (≠ S378), Y445 (= Y402), R465 (= R422), G481 (= G438), E494 (= E451), K498 (= K455)
- binding tryptophan: P287 (= P252), Y288 (≠ F253), M289 (≠ S254), G450 (= G407), C461 (≠ S418)
Sites not aligning to the query:
P00898 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
29% identity, 74% coverage: 115:460/467 of query aligns to 148:507/520 of P00898
- C174 (≠ N142) mutation to Y: Almost no change in feedback control by tryptophan.
- N288 (= N249) mutation to D: Decrease in feedback control by tryptophan.
- P289 (≠ Q250) mutation to L: Decrease in feedback control by tryptophan.
- M293 (≠ S254) mutation to T: Complete loss of feedback control by tryptophan.
- F294 (≠ A255) mutation to L: Decrease in feedback control by tryptophan.
- G305 (≠ S266) mutation to S: Decrease in feedback control by tryptophan.
- R402 (≠ T355) mutation to W: Almost no change in feedback control by tryptophan.
- G460 (= G413) mutation to D: Almost no change in feedback control by tryptophan.
- C465 (≠ S418) mutation to Y: Complete loss of feedback control by tryptophan. 4-fold decrease of affinity binding for chorismate.
Sites not aligning to the query:
- 39 E→K: Complete loss of feedback control by tryptophan.
- 40 binding ; S→F: Complete loss of feedback control by tryptophan.
- 41 A→V: Decrease in feedback control by tryptophan.
- 50 binding
- 128 R→H: Almost no change in feedback control by tryptophan.
- 515 H→Y: Almost no change in feedback control by tryptophan.
P00897 Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 from Serratia marcescens (see paper)
28% identity, 74% coverage: 115:460/467 of query aligns to 147:506/519 of P00897
Sites not aligning to the query:
1i7qA Anthranilate synthase from s. Marcescens (see paper)
28% identity, 74% coverage: 115:460/467 of query aligns to 145:504/517 of 1i7qA
- active site: Q260 (= Q223), E306 (= E270), A324 (≠ K286), E358 (= E314), H395 (= H351), T422 (≠ S378), Y446 (= Y402), R466 (= R422), G482 (= G438), E495 (= E451), K499 (= K455)
- binding magnesium ion: E358 (= E314), E495 (= E451)
- binding pyruvic acid: Y446 (= Y402), I465 (= I421), R466 (= R422), A479 (= A435), G480 (= G436), K499 (= K455)
1i7sA Anthranilate synthase from serratia marcescens in complex with its end product inhibitor l-tryptophan (see paper)
28% identity, 74% coverage: 115:460/467 of query aligns to 139:498/511 of 1i7sA
- active site: Q254 (= Q223), E300 (= E270), A318 (≠ K286), E352 (= E314), H389 (= H351), T416 (≠ S378), Y440 (= Y402), R460 (= R422), G476 (= G438), E489 (= E451), K493 (= K455)
- binding tryptophan: P282 (= P252), Y283 (≠ F253), M284 (≠ S254), V444 (≠ M406), G445 (= G407), D454 (= D416), C456 (≠ S418)
Sites not aligning to the query:
5jy9B An iron-bound structure of the salicylate synthase irp9 (see paper)
30% identity, 47% coverage: 246:463/467 of query aligns to 206:422/424 of 5jy9B
- active site: E230 (= E270), A246 (≠ K286), E274 (= E314), H311 (= H351), T338 (≠ S378), Y362 (= Y402), R381 (= R422), G397 (= G438), E410 (= E451), K414 (= K455)
- binding fe (ii) ion: E274 (= E314), E410 (= E451)
Sites not aligning to the query:
Query Sequence
>7025140 FitnessBrowser__ANA3:7025140
MANRAALPLAVRQLDWTFSTAAIFEYFAAEPWAILLDSANAPHQDAKFDMICAGPIATLI
TQGELTDIQVHQPELTKPTHLCPQDDPFTLVKQLLRHWYPHSFACDLPFSGGAMGSFSYD
LGRRIEQLPSTAAHDIHLGEMNIGFYDWALIFDYQQQSWFMVHYLGDAVLDTQLKIIEAK
IAKPTKQAEFRLTSPWSAQTTKAQYAAKFTQVQAYLHSGDCYQINLTQRFEAEYQGDEWR
AYCKLRSANQAPFSAFMRLDANAILSISPERFIQLRGDDIQTKPIKGTLPRHSDPMLDKQ
AAQALAHSPKDRAENVMIVDLLRNDIGKVAAPGTVQVPHLFAVESFPAVHHLVSTVTAKL
DPHYHACDLLRAAFPGGSITGAPKIRAMEIIEELEPSRRSLYCGSMGYISQDGQMDTSIT
IRTIVAEQGKLYCWAGGGIVADSNVDAEYQESFDKISRILPLLDSPQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory