SitesBLAST – Find functional sites

 

SitesBLAST

Comparing 7025244 FitnessBrowser__ANA3:7025244 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 20 (the maximum) hits to proteins with known functional sites (download)

7qyrD Crystal structure of rimk from pseudomonas aeruginosa pao1 (see paper)
36% identity, 83% coverage: 16:294/338 of query aligns to 10:286/293 of 7qyrD

query
sites
7qyrD
P
 
P
E
 
R
L
|
L
Y
 
Y
E
x
S
I
 
T
E
 
R
R
 
R
L
 
L
L
 
V
A
 
E
A
 
A
A
 
G
K
 
R
A
 
E
D
 
R
N
 
G
I
 
H
E
 
E
L
 
M
E
 
V
V
 
V
Y
 
I
A
 
-
P
 
-
D
 
D
E
 
T
F
 
L
D
 
R
L
 
A
T
 
Y
V
 
M
T
 
N
R
 
I
E
 
A
D
 
S
N
 
H
K
 
K
-
 
P
S
 
Q
I
 
I
L
 
H
L
 
Y
N
 
R
G
 
G
Q
 
Q
P
 
P
V
 
L
E
 
E
L
 
G
P
 
F
D
 
D
F
 
A
I
 
V
I
 
I
P
 
P
R
|
R
M
 
I
G
 
G
S
 
A
G
 
S
T
 
V
T
 
T
Y
 
F
F
 
Y
A
 
G
L
 
C
A
 
A
I
 
V
I
 
L
R
 
R
H
 
Q
L
 
F
E
 
E
R
 
M
L
 
M
G
 
G
V
 
V
Y
 
F
C
 
P
L
 
L
N
 
N
P
 
E
S
 
S
K
 
V
A
 
A
I
 
I
E
 
A
I
 
R
V
 
S
K
 
R
D
 
D
K
 
K
L
 
L
F
 
R
S
 
S
Q
 
L
Q
 
Q
L
 
L
L
 
L
A
 
S
E
 
R
K
 
K
N
 
G
L
 
I
P
 
G
T
 
L
P
 
P
K
 
V
T
 
T
M
 
G
L
 
F
V
 
A
K
 
H
F
 
S
P
 
P
V
 
D
D
 
D
I
 
V
-
 
P
E
 
D
L
 
L
V
 
I
E
 
E
R
 
M
H
 
V
L
 
G
G
 
G
F
 
A
P
 
P
V
 
L
V
|
V
I
 
I
K
 
K
T
 
L
L
 
L
S
 
E
G
 
G
S
 
T
Q
 
Q
G
 
G
S
 
I
G
 
G
V
 
V
F
 
V
L
 
L
S
 
C
H
 
E
K
 
T
A
 
E
R
 
K
E
 
A
F
 
A
D
 
E
D
 
S
L
 
V
M
 
L
Q
 
E
L
 
A
I
 
F
E
 
M
A
 
G
T
 
L
N
 
K
K
 
H
N
 
N
A
 
-
N
 
-
I
 
I
I
 
M
L
 
V
Q
 
Q
E
 
E
F
x
Y
I
|
I
A
 
K
N
 
E
S
 
A
H
 
G
G
 
G
R
 
A
D
|
D
L
 
I
R
|
R
V
 
C
F
 
F
T
 
V
I
 
V
G
 
G
G
 
D
R
 
K
V
 
V
A
 
I
G
 
A
C
 
S
Y
 
M
E
 
K
R
 
R
R
 
Q
G
 
A
Q
 
A
E
 
P
D
 
G
S
 
E
F
 
F
K
x
R
A
x
S
N
 
N
V
 
L
S
 
H
A
 
R
G
 
G
G
 
G
S
 
S
A
 
A
R
 
S
P
 
L
F
 
I
E
 
K
I
 
I
T
 
T
P
 
P
E
 
E
I
 
E
E
 
R
W
 
M
L
 
T
A
 
A
T
 
I
Q
 
R
T
 
A
A
 
A
N
 
R
I
 
V
L
 
M
D
 
G
L
 
L
D
 
N
V
 
V
A
 
A
G
 
G
I
 
V
D
 
D
L
 
I
L
|
L
F
 
R
D
 
S
N
 
N
G
 
H
H
 
G
Y
 
P
K
 
L
I
 
V
C
x
M
E
 
E
A
 
V
N
|
N
S
 
S
S
|
S
P
 
P
G
|
G
F
 
L
E
 
E
G
 
G
L
 
I
E
 
E
S
 
S
C
 
T
L
 
T
N
 
G
V
 
K
D
 
D
I
 
I
A
 
A
A
 
G
Q
 
I
I
 
I
L
 
I
H
 
Q
F
 
Y
I
 
L

Sites not aligning to the query:

4iwxA Rimk structure at 2.85a (see paper)
35% identity, 82% coverage: 18:294/338 of query aligns to 14:288/294 of 4iwxA

query
sites
4iwxA
L
 
L
Y
 
Y
E
 
S
I
 
C
E
 
K
R
 
R
L
 
L
L
 
R
A
 
E
A
 
A
A
 
A
K
 
I
A
 
Q
D
 
R
N
 
G
I
 
H
E
 
L
L
 
V
E
 
E
V
 
I
Y
 
L
A
 
D
P
 
P
D
 
L
E
 
S
F
 
C
D
 
Y
L
 
M
T
 
N
V
 
I
T
 
N
R
 
-
E
 
P
D
 
A
N
 
A
K
 
S
S
 
S
I
 
I
L
 
H
L
 
Y
N
 
K
G
 
G
Q
 
R
P
 
K
V
 
L
E
 
P
L
 
H
P
 
F
D
 
D
F
 
A
I
 
V
I
 
I
P
 
P
R
 
R
M
 
I
G
 
G
S
 
T
G
 
A
T
 
I
T
 
T
Y
 
F
F
 
Y
A
 
G
L
 
T
A
 
A
I
 
A
I
 
L
R
 
R
H
 
Q
L
 
F
E
 
E
R
 
M
L
 
L
G
 
G
V
 
S
Y
 
Y
C
 
P
L
 
L
N
 
N
P
 
E
S
 
S
K
 
V
A
 
A
I
 
I
E
 
A
I
x
R
V
 
A
K
 
R
D
 
D
K
 
K
L
 
L
F
x
R
S
 
S
Q
 
M
Q
|
Q
L
|
L
L
 
L
A
 
A
E
x
R
K
 
Q
N
 
G
L
 
I
P
 
D
T
 
L
P
 
P
K
 
V
T
 
T
M
 
G
L
 
I
V
 
A
K
 
H
F
 
S
P
 
P
V
 
D
D
 
D
I
 
T
-
 
S
E
 
D
L
 
L
V
 
I
E
 
D
R
 
M
H
 
V
L
 
G
G
 
G
F
 
A
P
 
P
V
 
L
V
|
V
I
 
V
K
|
K
T
 
L
L
 
V
S
 
E
G
 
G
S
 
T
Q
 
Q
G
 
G
S
 
I
G
 
G
V
 
V
F
 
V
L
 
L
S
 
A
H
 
E
K
 
T
A
 
R
R
 
Q
E
 
A
F
 
A
D
 
E
D
 
S
L
 
V
M
 
I
Q
 
D
L
 
A
I
 
F
E
 
R
A
 
G
T
 
L
N
 
N
K
 
-
N
 
-
A
 
A
N
 
H
I
 
I
I
 
L
L
 
V
Q
 
Q
E
|
E
F
x
Y
I
|
I
A
x
K
N
 
E
S
 
A
H
 
Q
G
 
G
R
 
C
D
|
D
L
 
I
R
 
R
V
 
C
F
 
L
T
 
V
I
 
V
G
 
G
G
 
D
R
 
E
V
 
V
A
 
V
G
 
A
C
 
A
Y
 
I
E
 
E
R
 
R
R
 
R
G
 
A
Q
 
K
E
 
E
D
 
G
S
 
D
F
 
F
K
x
R
A
x
S
N
|
N
V
 
L
S
 
H
A
 
R
G
 
G
G
 
G
S
 
A
A
 
A
R
 
S
P
 
V
F
 
A
E
 
S
I
 
I
T
 
T
P
 
P
E
 
Q
I
 
E
E
 
R
W
 
E
L
 
I
A
 
A
T
 
I
Q
 
K
T
 
A
A
 
A
N
 
R
I
 
T
L
 
M
D
 
A
L
 
L
D
 
D
V
 
V
A
 
A
G
 
G
I
 
V
D
 
D
L
 
I
L
 
L
F
 
R
D
 
A
N
 
N
G
 
R
H
 
G
Y
 
P
K
 
L
I
 
V
C
x
M
E
|
E
A
 
V
N
 
N
S
 
A
S
 
S
P
 
P
G
 
G
F
 
L
E
 
E
G
 
G
L
 
I
E
 
E
S
 
K
C
 
T
L
 
T
N
 
G
V
 
I
D
 
D
I
 
I
A
 
A
A
 
G
Q
 
K
I
 
M
L
 
I
H
 
R
F
 
W
I
 
I

5zctH The crystal structure of the poly-alpha-l-glutamate peptides synthetase rimk at 2.05 angstrom resolution. (see paper)
35% identity, 82% coverage: 18:294/338 of query aligns to 12:286/292 of 5zctH

query
sites
5zctH
L
 
L
Y
 
Y
E
 
S
I
 
C
E
 
K
R
 
R
L
 
L
L
 
R
A
 
E
A
 
A
A
 
A
K
 
I
A
 
Q
D
 
R
N
 
G
I
 
H
E
 
L
L
 
V
E
 
E
V
 
I
Y
 
L
A
 
D
P
 
P
D
 
L
E
 
S
F
 
C
D
 
Y
L
 
M
T
 
N
V
 
I
T
 
N
R
 
-
E
 
P
D
 
A
N
 
A
K
 
S
S
 
S
I
 
I
L
 
H
L
 
Y
N
 
K
G
 
G
Q
 
R
P
 
K
V
 
L
E
 
P
L
 
H
P
 
F
D
 
D
F
 
A
I
 
V
I
 
I
P
 
P
R
 
R
M
 
I
G
 
G
S
 
T
G
 
A
T
 
I
T
 
T
Y
 
F
F
 
Y
A
 
G
L
 
T
A
 
A
I
 
A
I
 
L
R
 
R
H
 
Q
L
 
F
E
 
E
R
 
M
L
 
L
G
 
G
V
 
S
Y
 
Y
C
 
P
L
 
L
N
 
N
P
 
E
S
 
S
K
 
V
A
 
A
I
 
I
E
 
A
I
 
R
V
 
A
K
 
R
D
 
D
K
 
K
L
 
L
F
 
R
S
 
S
Q
 
M
Q
 
Q
L
 
L
L
 
L
A
 
A
E
 
R
K
 
Q
N
 
G
L
 
I
P
 
D
T
 
L
P
 
P
K
 
V
T
 
T
M
 
G
L
 
I
V
 
A
K
 
H
F
 
S
P
 
P
V
 
D
D
 
D
I
 
T
-
 
S
E
 
D
L
 
L
V
 
I
E
 
D
R
 
M
H
 
V
L
 
G
G
 
G
F
 
A
P
 
P
V
 
L
V
|
V
I
 
V
K
|
K
T
 
L
L
 
V
S
 
E
G
 
G
S
 
T
Q
 
Q
G
 
G
S
 
I
G
 
G
V
 
V
F
 
V
L
 
L
S
 
A
H
 
E
K
 
T
A
 
R
R
 
Q
E
 
A
F
 
A
D
 
E
D
 
S
L
 
V
M
 
I
Q
 
D
L
 
A
I
 
F
E
 
R
A
 
G
T
 
L
N
 
N
K
 
-
N
 
-
A
 
A
N
 
H
I
 
I
I
 
L
L
 
V
Q
|
Q
E
 
E
F
x
Y
I
|
I
A
 
K
N
 
E
S
 
A
H
 
Q
G
 
G
R
 
C
D
|
D
L
 
I
R
 
R
V
 
C
F
 
L
T
 
V
I
 
V
G
 
G
G
 
D
R
 
E
V
 
V
A
 
V
G
 
A
C
 
A
Y
 
I
E
 
E
R
 
R
R
 
R
G
 
A
Q
 
K
E
 
E
D
 
G
S
 
D
F
|
F
K
x
R
A
x
S
N
|
N
V
 
L
S
 
H
A
x
R
G
 
G
G
 
G
S
 
A
A
 
A
R
 
S
P
 
V
F
 
A
E
 
S
I
 
I
T
 
T
P
 
P
E
 
Q
I
 
E
E
 
R
W
 
E
L
 
I
A
 
A
T
 
I
Q
 
K
T
 
A
A
 
A
N
 
R
I
 
T
L
 
M
D
 
A
L
 
L
D
 
D
V
 
V
A
 
A
G
 
G
I
 
V
D
|
D
L
 
I
L
|
L
F
 
R
D
 
A
N
 
N
G
 
R
H
 
G
Y
 
P
K
 
L
I
 
V
C
x
M
E
|
E
A
 
V
N
 
N
S
 
A
S
 
S
P
 
P
G
 
G
F
 
L
E
 
E
G
 
G
L
 
I
E
 
E
S
 
K
C
 
T
L
 
T
N
 
G
V
 
I
D
 
D
I
 
I
A
 
A
A
 
G
Q
 
K
I
 
M
L
 
I
H
 
R
F
 
W
I
 
I

5zctA The crystal structure of the poly-alpha-l-glutamate peptides synthetase rimk at 2.05 angstrom resolution. (see paper)
35% identity, 82% coverage: 18:294/338 of query aligns to 12:286/292 of 5zctA

query
sites
5zctA
L
 
L
Y
 
Y
E
 
S
I
 
C
E
 
K
R
 
R
L
 
L
L
 
R
A
 
E
A
 
A
A
 
A
K
 
I
A
 
Q
D
 
R
N
 
G
I
 
H
E
 
L
L
 
V
E
 
E
V
 
I
Y
 
L
A
 
D
P
 
P
D
 
L
E
 
S
F
 
C
D
 
Y
L
 
M
T
 
N
V
 
I
T
 
N
R
 
-
E
 
P
D
 
A
N
 
A
K
 
S
S
 
S
I
 
I
L
 
H
L
 
Y
N
 
K
G
 
G
Q
 
R
P
 
K
V
 
L
E
 
P
L
 
H
P
 
F
D
 
D
F
 
A
I
 
V
I
 
I
P
 
P
R
 
R
M
 
I
G
 
G
S
 
T
G
 
A
T
 
I
T
 
T
Y
 
F
F
 
Y
A
 
G
L
 
T
A
 
A
I
 
A
I
 
L
R
 
R
H
 
Q
L
 
F
E
 
E
R
 
M
L
 
L
G
 
G
V
 
S
Y
 
Y
C
 
P
L
 
L
N
 
N
P
 
E
S
 
S
K
 
V
A
 
A
I
 
I
E
 
A
I
 
R
V
 
A
K
 
R
D
 
D
K
|
K
L
 
L
F
 
R
S
 
S
Q
 
M
Q
 
Q
L
 
L
L
 
L
A
 
A
E
 
R
K
 
Q
N
 
G
L
 
I
P
 
D
T
 
L
P
 
P
K
 
V
T
 
T
M
 
G
L
 
I
V
 
A
K
 
H
F
 
S
P
 
P
V
 
D
D
 
D
I
 
T
-
 
S
E
 
D
L
 
L
V
 
I
E
 
D
R
 
M
H
 
V
L
 
G
G
 
G
F
 
A
P
 
P
V
 
L
V
 
V
I
 
V
K
|
K
T
 
L
L
 
V
S
 
E
G
 
G
S
x
T
Q
|
Q
G
|
G
S
 
I
G
 
G
V
 
V
F
 
V
L
 
L
S
 
A
H
 
E
K
 
T
A
 
R
R
 
Q
E
 
A
F
 
A
D
 
E
D
 
S
L
 
V
M
 
I
Q
 
D
L
 
A
I
 
F
E
 
R
A
 
G
T
 
L
N
 
N
K
 
-
N
 
-
A
 
A
N
 
H
I
 
I
I
 
L
L
 
V
Q
|
Q
E
 
E
F
x
Y
I
|
I
A
 
K
N
 
E
S
 
A
H
 
Q
G
 
G
R
 
C
D
 
D
L
 
I
R
 
R
V
 
C
F
 
L
T
 
V
I
 
V
G
 
G
G
 
D
R
 
E
V
 
V
A
 
V
G
 
A
C
 
A
Y
 
I
E
 
E
R
 
R
R
 
R
G
 
A
Q
 
K
E
 
E
D
 
G
S
 
D
F
 
F
K
x
R
A
x
S
N
|
N
V
 
L
S
 
H
A
 
R
G
 
G
G
 
G
S
 
A
A
 
A
R
 
S
P
 
V
F
 
A
E
 
S
I
 
I
T
 
T
P
 
P
E
 
Q
I
 
E
E
 
R
W
 
E
L
 
I
A
 
A
T
 
I
Q
 
K
T
 
A
A
 
A
N
 
R
I
 
T
L
 
M
D
 
A
L
 
L
D
 
D
V
 
V
A
 
A
G
 
G
I
 
V
D
 
D
L
 
I
L
|
L
F
 
R
D
 
A
N
 
N
G
 
R
H
 
G
Y
 
P
K
 
L
I
 
V
C
x
M
E
 
E
A
 
V
N
 
N
S
 
A
S
 
S
P
 
P
G
 
G
F
 
L
E
 
E
G
 
G
L
 
I
E
 
E
S
 
K
C
 
T
L
 
T
N
 
G
V
 
I
D
 
D
I
 
I
A
 
A
A
 
G
Q
 
K
I
 
M
L
 
I
H
 
R
F
 
W
I
 
I

3vpbB Argx from sulfolobus tokodaii complexed with lysw/glu/adp/mg/zn/sulfate (see paper)
27% identity, 65% coverage: 76:295/338 of query aligns to 56:277/282 of 3vpbB

query
sites
3vpbB
T
 
S
T
 
M
Y
 
Y
F
 
R
A
 
A
L
 
L
A
 
Y
I
 
S
I
 
S
R
 
A
H
 
V
L
 
L
E
 
E
R
 
A
L
 
A
G
 
G
V
 
V
Y
 
H
C
 
T
L
 
I
N
 
N
P
 
S
S
 
S
K
 
D
A
 
V
I
 
I
E
 
N
I
 
V
V
 
C
K
 
G
D
 
D
K
|
K
L
 
I
F
 
L
S
 
T
Q
 
Y
Q
 
S
L
 
K
L
 
L
A
 
Y
E
 
R
K
 
E
N
 
G
L
 
I
P
 
P
T
 
I
P
 
P
K
 
D
T
 
S
M
 
I
L
 
I
V
 
A
K
 
L
F
 
S
P
 
A
V
 
E
D
 
A
I
 
A
E
 
L
L
 
K
V
 
A
E
 
Y
R
 
E
H
 
Q
L
 
R
G
 
G
F
 
F
P
 
P
V
 
L
V
x
I
I
 
D
K
|
K
T
 
P
L
 
P
S
 
I
G
 
G
S
|
S
Q
 
W
G
|
G
S
 
R
G
 
L
V
|
V
F
 
S
L
 
L
S
 
I
H
 
R
K
 
D
A
 
V
R
 
F
E
 
E
F
 
G
D
 
K
D
 
T
L
 
I
M
 
I
Q
 
E
L
 
H
I
 
R
E
 
E
A
 
L
T
 
M
N
 
G
K
 
N
N
 
S
A
 
A
-
 
L
-
 
K
N
 
A
I
 
H
I
 
I
L
 
V
Q
|
Q
E
 
E
F
x
Y
I
|
I
A
 
-
N
 
Q
S
 
Y
H
 
K
G
 
G
R
 
R
D
|
D
L
 
I
R
 
R
V
 
C
F
 
I
T
 
A
I
 
I
G
 
G
G
 
E
R
 
E
V
 
L
A
 
L
G
 
G
C
 
C
Y
|
Y
E
 
A
R
|
R
R
 
N
G
 
I
Q
 
P
E
 
P
D
 
N
S
 
E
F
 
W
K
x
R
A
|
A
N
|
N
V
|
V
S
x
A
A
 
L
G
 
G
G
 
G
S
 
T
A
 
P
R
 
S
P
 
N
F
 
I
E
 
E
I
 
V
T
 
D
P
 
E
E
 
K
I
 
L
E
 
K
W
 
E
L
 
T
A
 
V
T
 
V
Q
 
K
T
 
A
A
 
V
N
 
S
I
 
I
L
 
V
D
 
H
L
 
G
D
 
E
V
 
F
A
 
V
G
 
S
I
 
I
D
|
D
L
 
I
L
 
L
-
 
E
F
 
H
D
 
P
N
 
N
G
 
K
H
 
G
Y
 
Y
K
 
V
I
 
V
C
x
N
E
|
E
A
 
L
N
|
N
S
 
D
S
 
V
P
 
P
G
x
E
F
 
F
E
 
K
G
|
G
L
 
F
E
 
M
S
 
V
C
 
A
L
 
T
N
 
N
V
 
I
D
 
N
I
 
V
A
 
A
A
 
Q
Q
 
K
I
 
L
L
 
V
H
 
E
F
 
Y
I
 
I
R
 
K

Q970U6 Glutamate--LysW ligase ArgX; EC 6.3.2.- from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
27% identity, 65% coverage: 76:295/338 of query aligns to 56:277/282 of Q970U6

query
sites
Q970U6
T
 
S
T
 
M
Y
 
Y
F
 
R
A
 
A
L
 
L
A
 
Y
I
 
S
I
 
S
R
 
A
H
 
V
L
 
L
E
 
E
R
 
A
L
 
A
G
 
G
V
 
V
Y
 
H
C
 
T
L
 
I
N
 
N
P
 
S
S
 
S
K
 
D
A
 
V
I
 
I
E
 
N
I
 
V
V
 
C
K
 
G
D
 
D
K
 
K
L
 
I
F
 
L
S
 
T
Q
 
Y
Q
 
S
L
 
K
L
 
L
A
 
Y
E
 
R
K
 
E
N
 
G
L
 
I
P
 
P
T
 
I
P
 
P
K
 
D
T
 
S
M
 
I
L
 
I
V
 
A
K
 
L
F
 
S
P
 
A
V
 
E
D
 
A
I
 
A
E
 
L
L
 
K
V
 
A
E
 
Y
R
 
E
H
 
Q
L
 
R
G
 
G
F
 
F
P
 
P
V
 
L
V
 
I
I
 
D
K
 
K
T
 
P
L
 
P
S
 
I
G
 
G
S
 
S
Q
 
W
G
 
G
S
 
R
G
 
L
V
 
V
F
 
S
L
 
L
S
 
I
H
 
R
K
 
D
A
 
V
R
 
F
E
 
E
F
 
G
D
 
K
D
 
T
L
 
I
M
 
I
Q
 
E
L
 
H
I
 
R
E
 
E
A
 
L
T
 
M
N
 
G
K
 
N
N
 
S
A
 
A
-
 
L
-
 
K
N
 
A
I
 
H
I
 
I
L
 
V
Q
 
Q
E
 
E
F
 
Y
I
 
I
A
 
-
N
 
Q
S
 
Y
H
 
K
G
 
G
R
 
R
D
 
D
L
 
I
R
 
R
V
 
C
F
 
I
T
 
A
I
 
I
G
 
G
G
 
E
R
 
E
V
 
L
A
 
L
G
 
G
C
 
C
Y
 
Y
E
 
A
R
 
R
R
 
N
G
 
I
Q
 
P
E
 
P
D
 
N
S
 
E
F
 
W
K
 
R
A
 
A
N
 
N
V
 
V
S
 
A
A
 
L
G
 
G
G
 
G
S
 
T
A
 
P
R
 
S
P
 
N
F
 
I
E
 
E
I
 
V
T
 
D
P
 
E
E
 
K
I
 
L
E
 
K
W
 
E
L
 
T
A
 
V
T
 
V
Q
 
K
T
 
A
A
 
V
N
 
S
I
 
I
L
 
V
D
 
H
L
 
G
D
 
E
V
 
F
A
 
V
G
 
S
I
 
I
D
|
D
L
 
I
L
 
L
-
 
E
F
 
H
D
 
P
N
 
N
G
 
K
H
 
G
Y
 
Y
K
 
V
I
 
V
C
 
N
E
|
E
A
 
L
N
|
N
S
 
D
S
 
V
P
 
P
G
 
E
F
 
F
E
 
K
G
 
G
L
 
F
E
 
M
S
 
V
C
 
A
L
 
T
N
 
N
V
 
I
D
 
N
I
 
V
A
 
A
A
 
Q
Q
 
K
I
 
L
L
 
V
H
 
E
F
 
Y
I
 
I
R
 
K

Q4JAP9 Alpha-aminoadipate--LysW ligase LysX; AAA--LysW ligase LysX; EC 6.3.2.43 from Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) (see paper)
30% identity, 68% coverage: 66:295/338 of query aligns to 43:271/276 of Q4JAP9

query
sites
Q4JAP9
D
 
D
F
 
V
I
 
I
I
 
I
P
 
Q
R
 
R
M
 
N
G
 
T
S
 
S
G
 
H
T
 
A
T
 
R
Y
 
A
F
 
L
A
 
T
L
 
T
A
 
S
I
 
L
I
 
I
R
 
-
H
 
-
L
 
F
E
 
E
R
 
G
L
 
W
G
 
N
V
 
Y
Y
 
N
C
 
V
L
 
V
N
 
N
P
 
D
S
 
A
K
 
T
A
 
S
I
 
L
E
 
F
I
 
K
V
 
C
K
 
G
D
 
N
K
 
K
L
 
L
F
 
Y
S
 
T
Q
 
L
Q
 
S
L
 
L
L
 
L
A
 
A
E
 
K
K
 
H
N
 
N
L
 
I
P
 
K
T
 
T
P
 
P
K
 
R
T
 
T
M
 
-
L
 
I
V
 
V
K
 
T
F
 
F
P
 
S
V
 
K
D
 
D
I
 
K
E
 
A
L
 
V
-
 
D
V
 
L
E
 
A
R
 
K
H
 
K
L
 
I
G
 
G
F
 
F
P
 
P
V
 
A
V
 
V
I
 
I
K
 
K
T
 
P
L
 
I
S
 
E
G
 
G
S
 
S
Q
 
W
G
 
G
S
 
R
G
 
M
V
 
V
F
 
-
L
 
-
S
 
-
H
 
A
K
 
K
A
 
A
R
 
V
E
 
D
F
 
E
D
 
D
D
 
I
L
 
L
M
 
Y
Q
 
S
L
 
F
I
 
L
E
 
E
-
 
Y
-
 
Q
-
 
E
-
 
Y
A
 
T
T
 
T
N
 
S
K
 
Q
N
 
F
A
 
R
N
 
Q
I
 
I
I
 
Y
L
 
L
-
 
V
Q
 
Q
E
 
E
F
 
F
I
 
V
A
 
K
N
 
K
S
 
P
H
 
N
G
 
-
R
 
R
D
 
D
L
 
I
R
 
R
V
 
I
F
 
F
T
 
V
I
 
M
G
 
G
G
 
D
R
 
E
V
 
A
-
 
P
A
 
V
G
 
G
C
 
I
Y
 
Y
E
 
-
R
 
-
R
 
R
G
 
V
Q
 
N
E
 
E
D
 
R
S
 
N
F
 
W
K
 
K
A
 
T
N
 
N
V
 
T
S
 
A
A
 
L
G
 
G
G
 
A
S
 
R
A
 
A
R
 
L
P
 
P
F
 
L
E
 
K
I
 
I
T
 
D
P
 
D
E
 
E
I
 
L
E
 
R
W
 
D
L
 
L
A
 
A
T
 
L
Q
 
K
T
 
V
A
 
R
N
 
D
I
 
I
L
 
M
D
 
G
L
 
G
D
 
F
V
 
F
A
 
L
G
 
G
I
 
I
D
 
D
L
 
I
L
 
F
F
 
E
D
 
D
-
 
P
N
 
E
G
 
R
H
 
G
Y
 
Y
K
 
L
I
 
V
C
 
N
E
 
E
A
 
V
N
 
N
S
 
G
S
 
V
P
 
P
G
 
E
F
 
Y
E
 
K
G
x
N
L
x
T
E
 
V
S
 
R
C
 
V
L
 
N
N
 
N
V
 
F
D
 
N
I
 
V
A
 
S
A
 
S
Q
 
Y
I
 
L
L
 
L
H
 
N
F
 
K
I
 
L
R
 
R

3vpdA Lysx from thermus thermophilus complexed with amp-pnp (see paper)
29% identity, 63% coverage: 81:293/338 of query aligns to 63:274/281 of 3vpdA

query
sites
3vpdA
L
 
L
A
 
A
I
 
A
I
 
A
R
 
R
H
 
Y
L
 
L
E
 
T
R
 
A
L
 
L
G
 
G
V
 
I
Y
 
P
C
 
V
L
 
V
N
 
N
P
 
R
S
 
P
K
 
E
A
 
V
I
 
I
E
 
E
I
 
A
V
 
C
K
 
G
D
 
D
K
 
K
L
 
W
F
 
A
S
 
T
Q
 
S
Q
 
V
L
 
A
L
 
L
A
 
A
E
 
K
K
 
A
N
 
G
L
 
L
P
 
P
T
 
Q
P
 
P
K
 
K
T
 
T
M
 
A
L
 
L
V
 
A
K
 
T
F
 
D
P
 
R
V
 
E
D
 
E
I
 
A
E
 
L
L
 
R
V
 
L
E
 
M
R
 
E
H
 
A
L
 
F
G
 
G
F
 
Y
P
 
P
V
 
V
V
|
V
I
 
L
K
|
K
T
 
P
L
 
V
S
 
I
G
 
G
S
 
S
Q
x
W
G
|
G
S
 
R
G
 
L
V
x
L
F
 
A
L
 
K
S
 
V
H
 
T
K
 
D
A
 
R
R
 
A
E
 
A
F
 
A
D
 
E
D
 
A
L
 
L
M
 
L
Q
 
E
L
 
H
I
 
K
E
 
E
A
 
V
T
 
L
N
 
G
-
 
G
-
 
F
K
 
Q
N
 
H
A
 
Q
N
 
L
I
 
F
I
 
Y
L
 
I
Q
|
Q
E
 
E
F
 
Y
I
x
V
A
 
-
N
 
E
S
x
K
H
 
P
G
 
G
R
 
R
D
|
D
L
 
I
R
 
R
V
 
V
F
 
F
T
 
V
I
 
V
G
 
G
G
 
E
R
 
R
-
 
A
V
 
I
A
 
A
G
 
A
C
 
I
Y
 
Y
E
x
R
R
 
R
R
 
S
G
 
A
Q
 
H
E
 
-
D
 
-
S
 
-
F
x
W
K
 
I
A
x
T
N
 
N
V
 
T
S
 
A
A
 
R
G
 
G
G
 
G
S
 
Q
A
 
A
R
 
E
P
 
N
F
 
C
E
 
P
I
 
L
T
 
T
P
 
E
E
 
E
I
 
I
E
 
A
W
 
R
L
 
L
A
 
S
T
 
V
Q
 
G
T
 
A
A
 
A
N
 
E
I
 
A
L
 
V
D
 
G
L
 
G
D
 
G
V
 
V
A
 
V
G
 
A
I
 
V
D
 
D
L
 
L
L
x
F
F
 
E
D
 
S
N
 
E
G
 
R
H
 
G
Y
 
L
K
 
L
I
 
V
C
 
N
E
|
E
A
 
V
N
 
N
S
 
H
S
 
T
P
 
M
G
 
E
F
|
F
E
x
K
G
x
N
L
x
S
E
 
V
S
 
H
C
 
T
L
 
T
N
 
G
V
 
V
D
 
D
I
 
I
A
 
P
A
 
G
Q
 
E
I
 
I
L
 
L
H
 
R
F
 
Y

5k2mI Bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma- aaa (see paper)
27% identity, 63% coverage: 80:293/338 of query aligns to 56:266/273 of 5k2mI

query
sites
5k2mI
A
 
A
L
 
L
A
 
Y
I
 
T
I
 
A
R
 
R
H
 
L
L
 
F
E
 
E
R
 
S
L
 
E
G
 
G
V
 
I
Y
 
P
C
 
T
L
 
V
N
 
N
P
 
S
S
 
S
K
 
R
A
 
L
I
 
I
E
 
F
I
 
E
V
 
A
K
 
G
D
 
D
K
|
K
L
 
L
F
 
F
S
 
A
Q
 
T
Q
 
L
L
 
R
L
 
L
A
 
A
E
 
G
K
 
K
N
 
-
L
 
V
P
 
P
T
 
V
P
 
P
K
 
E
T
 
W
M
 
K
L
 
A
V
 
A
K
 
L
F
 
S
P
 
E
V
 
G
D
 
G
I
 
A
E
 
L
L
 
R
V
 
V
E
 
P
R
 
D
H
 
S
L
 
L
G
 
G
F
 
Y
P
 
P
V
 
L
V
|
V
I
 
S
K
|
K
T
 
P
L
 
V
S
x
F
G
 
G
S
|
S
Q
x
W
G
 
G
S
x
R
G
 
-
V
 
-
F
 
-
L
 
L
S
x
L
H
 
A
K
 
K
A
 
V
R
 
N
E
 
D
F
 
R
D
 
D
D
 
S
L
 
L
M
 
E
Q
 
A
L
 
V
I
 
L
E
 
E
A
 
H
T
 
R
N
 
K
K
 
W
N
 
M
A
 
K
N
|
N
I
 
P
I
 
L
-
x
Y
-
 
G
-
 
I
-
 
H
-
 
Y
L
 
F
Q
|
Q
E
 
E
F
 
F
I
x
V
A
 
E
N
x
K
S
 
P
H
 
-
G
 
G
R
 
R
D
|
D
L
 
I
R
|
R
V
 
S
F
 
Y
T
 
V
I
 
I
G
 
G
G
 
G
R
 
E
V
 
F
A
 
V
G
 
G
C
 
A
Y
 
I
E
 
Y
R
 
R
R
 
-
G
 
-
Q
 
Y
E
 
S
D
 
N
S
 
H
F
x
W
K
x
I
A
x
T
N
|
N
V
x
T
S
x
A
A
 
R
G
 
G
G
 
G
S
 
K
A
 
A
R
 
E
P
 
P
F
 
C
E
 
S
I
 
-
T
 
D
P
 
P
E
 
E
I
 
V
E
 
E
W
 
E
L
 
L
A
 
S
T
 
V
Q
 
K
T
 
A
A
 
W
N
 
E
I
 
A
L
 
F
D
 
G
L
 
E
D
 
G
V
 
A
A
 
L
G
 
A
I
 
I
D
 
D
L
 
I
L
x
F
F
 
E
D
 
S
N
 
E
G
 
K
H
 
G
Y
 
L
K
 
L
I
 
V
C
x
N
E
|
E
A
 
V
N
 
N
S
 
P
S
x
N
P
 
M
G
x
E
F
|
F
E
 
K
G
x
N
L
 
A
E
 
A
S
 
R
C
 
V
L
 
T
N
 
G
V
 
A
D
 
D
I
 
M
A
 
A
A
 
G
Q
 
K
I
 
L
L
 
V
H
 
E
F
 
Y

Sites not aligning to the query:

5k2mG Bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma- aaa (see paper)
27% identity, 63% coverage: 80:293/338 of query aligns to 56:266/273 of 5k2mG

query
sites
5k2mG
A
 
A
L
 
L
A
 
Y
I
 
T
I
 
A
R
 
R
H
 
L
L
 
F
E
 
E
R
 
S
L
 
E
G
 
G
V
 
I
Y
 
P
C
 
T
L
 
V
N
 
N
P
 
S
S
 
S
K
 
R
A
 
L
I
 
I
E
 
F
I
 
E
V
 
A
K
 
G
D
 
D
K
|
K
L
 
L
F
 
F
S
 
A
Q
 
T
Q
 
L
L
 
R
L
 
L
A
 
A
E
 
G
K
 
K
N
 
-
L
 
V
P
 
P
T
 
V
P
 
P
K
 
E
T
 
W
M
 
K
L
 
A
V
 
A
K
 
L
F
 
S
P
 
E
V
 
G
D
 
G
I
 
A
E
 
L
L
 
R
V
 
V
E
 
P
R
 
D
H
 
S
L
 
L
G
 
G
F
 
Y
P
 
P
V
 
L
V
|
V
I
 
S
K
|
K
T
 
P
L
 
V
S
x
F
G
 
G
S
|
S
Q
x
W
G
|
G
S
x
R
G
 
-
V
 
-
F
 
-
L
 
L
S
 
L
H
 
A
K
 
K
A
 
V
R
 
N
E
 
D
F
 
R
D
 
D
D
 
S
L
 
L
M
 
E
Q
 
A
L
 
V
I
 
L
E
 
E
A
 
H
T
 
R
N
 
K
K
 
W
N
 
M
A
 
K
N
 
N
I
 
P
I
 
L
-
x
Y
-
 
G
-
 
I
-
 
H
-
 
Y
L
 
F
Q
|
Q
E
 
E
F
 
F
I
x
V
A
 
E
N
x
K
S
 
P
H
 
-
G
 
G
R
 
R
D
|
D
L
 
I
R
|
R
V
 
S
F
 
Y
T
 
V
I
 
I
G
 
G
G
 
G
R
 
E
V
 
F
A
 
V
G
 
G
C
 
A
Y
 
I
E
 
Y
R
|
R
R
 
-
G
 
-
Q
 
Y
E
 
S
D
 
N
S
 
H
F
x
W
K
 
I
A
x
T
N
|
N
V
x
T
S
x
A
A
 
R
G
 
G
G
 
G
S
 
K
A
 
A
R
 
E
P
 
P
F
 
C
E
 
S
I
 
-
T
 
D
P
 
P
E
 
E
I
 
V
E
 
E
W
 
E
L
 
L
A
 
S
T
 
V
Q
 
K
T
 
A
A
 
W
N
 
E
I
 
A
L
 
F
D
 
G
L
 
E
D
 
G
V
 
A
A
 
L
G
 
A
I
 
I
D
|
D
L
 
I
L
x
F
F
 
E
D
 
S
N
 
E
G
 
K
H
 
G
Y
 
L
K
 
L
I
 
V
C
x
N
E
|
E
A
 
V
N
|
N
S
x
P
S
x
N
P
 
M
G
x
E
F
|
F
E
 
K
G
x
N
L
x
A
E
 
A
S
 
R
C
 
V
L
 
T
N
 
G
V
 
A
D
 
D
I
 
M
A
 
A
A
 
G
Q
 
K
I
 
L
L
 
V
H
 
E
F
 
Y

Sites not aligning to the query:

1uc9A Crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8 (see paper)
24% identity, 71% coverage: 55:293/338 of query aligns to 37:250/256 of 1uc9A

query
sites
1uc9A
I
 
M
L
 
V
L
 
L
N
 
G
G
 
E
Q
 
R
P
 
P
V
 
K
E
 
E
L
 
L
P
 
E
D
 
G
F
 
V
I
 
T
I
 
V
P
 
A
R
 
L
M
 
E
G
 
R
S
 
C
G
 
V
T
 
S
T
 
Q
Y
 
S
F
 
R
A
 
G
L
 
L
A
 
A
I
 
A
I
 
A
R
 
R
H
 
Y
L
 
L
E
 
T
R
 
A
L
 
L
G
 
G
V
 
I
Y
 
P
C
 
V
L
 
V
N
 
N
P
 
R
S
 
P
K
 
E
A
 
V
I
 
I
E
 
E
I
 
A
V
 
C
K
 
G
D
 
D
K
 
K
L
 
W
F
 
A
S
 
T
Q
 
S
Q
 
V
L
 
A
L
 
L
A
 
A
E
 
K
K
 
A
N
 
G
L
 
L
P
 
P
T
 
Q
P
 
P
K
 
K
T
 
T
M
 
A
L
 
L
V
 
A
K
 
T
F
 
D
P
 
R
V
 
E
D
 
E
I
 
A
E
 
L
L
 
R
V
 
L
E
 
M
R
 
E
H
 
A
L
 
F
G
 
G
F
 
Y
P
 
P
V
 
V
V
 
V
I
 
L
K
|
K
T
 
P
L
 
V
S
 
I
G
 
G
S
 
A
Q
 
A
G
 
A
S
 
A
G
 
A
V
 
A
F
 
A
L
 
A
S
 
A
H
 
A
K
 
A
A
 
A
R
 
A
E
 
A
F
 
A
D
 
A
D
 
G
L
 
F
M
 
Q
Q
 
H
L
 
Q
I
 
L
E
 
-
A
 
-
T
 
-
N
 
-
K
 
-
N
 
-
A
 
-
N
 
-
I
 
F
I
 
Y
L
 
I
Q
 
Q
E
 
E
F
x
Y
I
x
V
A
 
-
N
 
E
S
 
K
H
 
P
G
 
G
R
 
R
D
|
D
L
 
I
R
 
R
V
 
V
F
 
F
T
 
V
I
 
V
G
 
G
G
 
E
R
 
R
V
 
A
A
 
I
G
 
A
C
 
A
Y
 
I
E
 
Y
R
|
R
R
 
-
G
 
-
Q
 
-
E
 
-
D
 
-
S
 
-
F
 
-
K
 
-
A
 
-
N
 
-
V
 
-
S
 
-
A
 
-
G
 
-
G
 
-
S
 
-
A
 
A
R
 
E
P
 
N
F
 
C
E
 
P
I
 
L
T
 
T
P
 
E
E
 
E
I
 
V
E
 
A
W
 
R
L
 
L
A
 
S
T
 
V
Q
 
K
T
 
A
A
 
A
N
 
E
I
 
A
L
 
V
D
 
G
L
 
G
D
 
G
V
 
V
A
 
V
G
 
A
I
 
V
D
 
D
L
 
L
L
x
F
F
 
E
D
 
S
N
 
E
G
 
R
H
 
G
Y
 
L
K
 
L
I
 
V
C
x
N
E
 
E
A
 
V
N
 
N
S
 
H
S
 
T
P
 
M
G
 
E
F
 
F
E
 
K
G
 
N
L
 
S
E
 
V
S
 
H
C
 
T
L
 
T
N
 
G
V
 
V
D
 
D
I
 
I
A
 
P
A
 
G
Q
 
E
I
 
I
L
 
L
H
 
K
F
 
Y

7waeB Trichodesmium erythraeum cyanophycin synthetase 1 (tecpha1) with atpgammas, 4x(beta-asp-arg), and aspartate (see paper)
25% identity, 33% coverage: 100:211/338 of query aligns to 213:323/877 of 7waeB

query
sites
7waeB
A
 
G
I
 
V
E
 
E
I
 
L
V
 
A
K
 
C
D
 
D
K
 
K
L
 
E
F
 
G
S
 
T
Q
 
K
Q
 
R
L
 
I
L
 
L
A
 
K
E
 
D
K
 
A
N
 
G
L
 
V
P
 
P
T
 
V
P
 
P
K
 
R
T
 
G
M
 
T
L
 
V
V
 
A
K
 
R
F
 
Y
P
 
F
V
 
D
D
 
E
I
 
L
E
 
Q
-
 
D
L
 
A
V
 
I
E
 
E
R
 
Y
H
 
V
L
 
G
G
 
G
F
 
Y
P
 
P
V
 
I
V
 
V
I
 
I
K
|
K
T
 
P
L
 
L
S
 
D
G
 
G
S
 
N
Q
 
H
G
 
G
S
 
R
G
 
G
V
x
I
F
 
T
L
 
I
S
 
D
H
 
V
K
 
K
A
 
N
-
 
W
R
 
Q
E
 
E
F
 
A
D
 
E
D
 
E
L
 
A
M
 
Y
Q
 
D
L
 
L
I
 
A
E
 
R
A
 
K
T
 
A
N
 
S
K
 
K
N
 
T
A
 
K
N
 
T
I
 
V
I
 
I
L
 
V
Q
x
E
E
 
R
F
 
Y
I
x
Y
A
 
T
N
 
-
S
 
-
H
 
-
G
 
G
R
 
K
D
|
D
L
 
H
R
|
R
V
 
V
F
 
L
T
 
V
I
 
V
G
 
N
G
 
G
R
 
K
V
 
V
A
 
V
G
 
A
C
 
V
Y
 
A
E
 
E
R
 
R

Sites not aligning to the query:

7waeD Trichodesmium erythraeum cyanophycin synthetase 1 (tecpha1) with atpgammas, 4x(beta-asp-arg), and aspartate (see paper)
25% identity, 33% coverage: 100:211/338 of query aligns to 213:323/724 of 7waeD

query
sites
7waeD
A
 
G
I
 
V
E
 
E
I
 
L
V
 
A
K
 
C
D
 
D
K
|
K
L
 
E
F
 
G
S
 
T
Q
 
K
Q
 
R
L
 
I
L
 
L
A
 
K
E
 
D
K
 
A
N
 
G
L
 
V
P
 
P
T
 
V
P
 
P
K
 
R
T
 
G
M
 
T
L
 
V
V
 
A
K
 
R
F
 
Y
P
 
F
V
 
D
D
 
E
I
 
L
E
 
Q
-
 
D
L
 
A
V
 
I
E
 
E
R
 
Y
H
 
V
L
 
G
G
 
G
F
 
Y
P
 
P
V
 
I
V
|
V
I
 
I
K
|
K
T
 
P
L
 
L
S
 
D
G
|
G
S
x
N
Q
x
H
G
|
G
S
 
R
G
 
G
V
x
I
F
 
T
L
x
I
S
 
D
H
 
V
K
 
K
A
 
N
-
 
W
R
 
Q
E
 
E
F
 
A
D
 
E
D
 
E
L
 
A
M
 
Y
Q
 
D
L
 
L
I
 
A
E
 
R
A
 
K
T
 
A
N
 
S
K
 
K
N
 
T
A
 
K
N
 
T
I
 
V
I
 
I
L
 
V
Q
x
E
E
 
R
F
 
Y
I
x
Y
A
 
T
N
 
-
S
 
-
H
 
-
G
 
G
R
 
K
D
|
D
L
 
H
R
|
R
V
 
V
F
 
L
T
 
V
I
 
V
G
 
N
G
 
G
R
 
K
V
 
V
A
 
V
G
 
A
C
 
V
Y
 
A
E
 
E
R
 
R

Sites not aligning to the query:

7lgmA Cyanophycin synthetase from a. Baylyi dsm587 with atp (see paper)
31% identity, 33% coverage: 100:211/338 of query aligns to 211:318/719 of 7lgmA

query
sites
7lgmA
A
 
A
I
 
V
E
 
E
I
 
I
V
 
A
K
 
G
D
 
D
K
 
K
L
 
N
F
 
V
S
 
C
Q
 
N
Q
 
Q
L
 
L
L
 
L
A
 
Q
E
 
D
K
 
L
N
 
G
L
 
L
P
 
P
T
 
V
P
 
P
K
 
K
T
 
Q
M
 
R
L
 
V
V
 
V
K
 
Y
F
 
D
P
 
I
V
 
D
D
 
D
I
 
A
E
 
V
L
 
R
V
 
A
E
 
A
R
 
R
H
 
R
L
 
V
G
 
G
F
 
F
P
 
P
V
 
V
V
|
V
I
 
L
K
 
K
T
 
P
L
 
L
S
 
D
G
 
G
S
 
N
Q
 
H
G
 
G
S
x
R
G
 
G
V
 
V
F
 
S
L
 
V
S
 
N
H
 
L
K
 
T
A
 
T
R
 
D
E
 
E
F
 
A
D
 
V
D
 
E
L
 
A
M
 
A
Q
 
F
L
 
D
I
 
I
E
 
-
A
 
A
T
 
M
N
 
S
K
 
E
N
 
G
A
 
S
N
 
A
I
 
V
I
 
I
L
 
V
Q
 
E
E
 
S
F
x
M
I
x
L
A
 
-
N
 
-
S
 
-
H
 
Y
G
 
G
R
 
D
D
|
D
L
 
H
R
 
R
V
 
L
F
 
L
T
 
V
I
 
V
G
 
N
G
 
G
R
 
E
V
 
L
A
 
V
G
 
A
C
 
A
Y
 
A
E
 
R
R
 
R

Sites not aligning to the query:

7txuA Cyanophycin synthetase 1 from synechocystis sp. Utex2470 with atp and 16x(asp-arg)
25% identity, 38% coverage: 100:228/338 of query aligns to 213:331/869 of 7txuA

query
sites
7txuA
A
 
G
I
 
V
E
 
E
I
 
L
V
 
A
K
 
C
D
 
D
K
 
K
L
 
E
F
 
G
S
 
T
Q
 
K
Q
 
T
L
 
I
L
 
L
A
 
Q
E
 
D
K
 
A
N
 
G
L
 
I
P
 
P
T
 
V
P
 
P
K
 
R
T
 
G
M
 
T
L
 
T
V
 
I
K
 
Q
F
 
Y
P
 
F
V
 
D
D
 
D
I
 
L
E
 
E
-
 
E
L
 
A
V
 
I
E
 
N
R
 
D
H
 
V
L
 
G
G
 
G
F
 
Y
P
 
P
V
 
V
V
 
V
I
 
I
K
 
K
T
 
P
L
 
L
S
 
D
G
 
G
S
 
N
Q
 
H
G
|
G
S
 
R
G
 
G
V
x
I
F
 
T
L
 
I
S
 
N
H
 
-
K
 
-
A
 
V
R
 
R
E
 
H
F
 
W
D
 
Q
D
 
E
L
 
A
M
 
I
Q
 
A
L
 
A
I
 
Y
E
 
D
A
 
L
T
 
A
N
 
A
K
 
E
N
 
E
A
 
S
N
 
K
I
 
I
I
 
I
L
 
V
Q
 
E
E
 
R
F
x
Y
I
x
Y
A
 
-
N
 
-
S
 
-
H
 
E
G
 
G
R
 
S
D
|
D
L
 
H
R
 
R
V
 
V
F
 
L
T
 
V
I
 
V
G
 
N
G
 
G
R
 
K
V
 
L
A
 
V
G
 
A
C
 
V
Y
 
A
E
 
E
R
 
R
R
 
-
G
 
-
Q
 
-
E
 
-
D
 
-
S
 
-
F
 
I
K
 
P
A
 
A
N
 
H
V
 
V
S
 
T
A
 
G
G
 
D
G
 
G
S
 
S
A
 
S

Sites not aligning to the query:

7lgjA Cyanophycin synthetase 1 from synechocystis sp. Utex2470 with adpcp and 8x(asp-arg)-nh2 (see paper)
25% identity, 38% coverage: 100:228/338 of query aligns to 213:331/869 of 7lgjA

query
sites
7lgjA
A
 
G
I
x
V
E
 
E
I
 
L
V
 
A
K
 
C
D
 
D
K
 
K
L
 
E
F
 
G
S
 
T
Q
 
K
Q
 
T
L
 
I
L
 
L
A
 
Q
E
 
D
K
 
A
N
 
G
L
 
I
P
 
P
T
 
V
P
 
P
K
 
R
T
 
G
M
 
T
L
 
T
V
 
I
K
 
Q
F
 
Y
P
 
F
V
 
D
D
 
D
I
 
L
E
 
E
-
 
E
L
 
A
V
 
I
E
 
N
R
 
D
H
 
V
L
 
G
G
 
G
F
 
Y
P
 
P
V
 
V
V
 
V
I
 
I
K
 
K
T
 
P
L
 
L
S
 
D
G
 
G
S
 
N
Q
 
H
G
 
G
S
 
R
G
 
G
V
 
I
F
 
T
L
 
I
S
 
N
H
 
-
K
 
-
A
 
V
R
 
R
E
 
H
F
 
W
D
 
Q
D
 
E
L
 
A
M
 
I
Q
 
A
L
 
A
I
 
Y
E
 
D
A
 
L
T
 
A
N
 
A
K
 
E
N
 
E
A
 
S
N
 
K
I
 
I
I
 
I
L
 
V
Q
 
E
E
 
R
F
 
Y
I
x
Y
A
 
-
N
 
-
S
 
-
H
 
E
G
 
G
R
 
S
D
|
D
L
 
H
R
 
R
V
 
V
F
 
L
T
 
V
I
 
V
G
 
N
G
 
G
R
 
K
V
 
L
A
 
V
G
 
A
C
 
V
Y
 
A
E
 
E
R
 
R
R
 
-
G
 
-
Q
 
-
E
 
-
D
 
-
S
 
-
F
 
I
K
 
P
A
 
A
N
 
H
V
 
V
S
 
T
A
 
G
G
 
D
G
 
G
S
 
S
A
 
S

Sites not aligning to the query:

7drpA Structure of atp-grasp ligase psnb complexed with phosphomimetic variant of minimal precursor, mg, and adp (see paper)
25% identity, 61% coverage: 82:288/338 of query aligns to 107:300/312 of 7drpA

query
sites
7drpA
A
 
A
I
 
V
I
 
L
R
 
L
H
 
R
L
 
W
E
 
E
R
 
E
L
 
A
G
 
G
V
 
T
Y
 
A
C
 
V
L
 
Y
N
 
N
P
 
S
S
 
P
K
 
R
A
 
A
I
 
S
E
 
A
I
 
N
V
 
I
K
 
T
D
 
-
K
 
K
L
 
P
F
 
F
S
 
Q
Q
 
L
Q
 
A
L
 
L
L
 
L
A
 
R
E
 
D
K
 
A
N
 
G
L
 
L
P
 
P
T
 
V
P
 
P
K
 
R
T
 
S
M
 
L
L
 
W
V
 
T
K
 
N
F
 
D
P
 
P
V
 
E
D
 
A
I
 
V
E
 
R
L
 
R
V
 
F
E
 
H
R
 
A
H
 
E
L
 
V
G
 
G
F
 
D
P
 
C
V
 
I
V
x
Y
I
x
K
K
 
P
T
 
V
L
 
A
S
 
G
G
|
G
S
x
A
Q
 
R
G
x
T
S
x
R
G
 
K
V
 
-
F
 
-
L
 
L
S
 
E
H
 
A
K
 
K
A
 
D
R
 
L
E
 
E
F
 
A
D
 
D
D
x
R
L
 
I
M
 
E
Q
x
R
L
|
L
I
 
-
E
 
-
A
 
-
T
 
-
N
 
-
K
 
S
N
 
A
A
 
A
N
 
P
I
x
V
I
 
C
L
 
F
Q
|
Q
E
|
E
F
 
L
I
x
L
A
 
T
N
 
-
S
 
-
H
 
-
G
 
G
R
 
D
D
|
D
L
 
V
R
|
R
V
 
V
F
 
Y
T
 
V
I
 
I
G
 
D
G
 
D
R
 
Q
V
 
V
A
 
I
G
 
C
C
 
A
Y
 
L
E
 
R
R
 
I
R
 
V
G
 
T
Q
 
D
E
 
E
D
 
I
S
 
D
F
 
F
K
 
R
A
 
-
N
 
-
V
 
-
S
 
Q
A
 
A
G
 
E
G
 
E
S
 
R
A
 
I
R
 
E
P
 
A
F
 
I
E
 
E
I
 
I
T
 
S
P
 
D
E
 
E
I
 
V
E
 
K
W
 
D
L
 
Q
A
 
C
T
 
V
Q
 
R
T
 
A
A
 
A
N
 
K
I
 
L
L
 
V
D
 
G
L
 
L
D
 
R
V
 
Y
A
 
T
G
 
G
I
 
M
D
|
D
L
 
I
L
x
K
F
 
A
D
 
G
-
 
A
N
 
D
G
 
G
H
 
N
Y
 
Y
K
 
R
I
 
V
C
x
L
E
|
E
A
 
L
N
|
N
S
 
A
S
|
S
P
x
A
G
x
M
F
 
F
E
 
R
G
 
G
L
 
F
E
 
E
S
 
G
C
 
R
L
 
A
N
 
N
V
 
V
D
 
D
I
 
I
A
 
C
A
 
G

Sites not aligning to the query:

7drnA Structure of atp-grasp ligase psnb complexed with precursor peptide psna2 and amppnp (see paper)
25% identity, 61% coverage: 82:288/338 of query aligns to 107:300/311 of 7drnA

query
sites
7drnA
A
 
A
I
 
V
I
 
L
R
 
L
H
 
R
L
 
W
E
 
E
R
 
E
L
 
A
G
 
G
V
 
T
Y
 
A
C
 
V
L
 
Y
N
 
N
P
 
S
S
 
P
K
 
R
A
 
A
I
 
S
E
 
A
I
 
N
V
 
I
K
 
T
D
 
-
K
 
K
L
 
P
F
 
F
S
 
Q
Q
 
L
Q
 
A
L
 
L
L
 
L
A
 
R
E
 
D
K
 
A
N
 
G
L
 
L
P
 
P
T
 
V
P
 
P
K
 
R
T
 
S
M
 
L
L
 
W
V
 
T
K
 
N
F
 
D
P
 
P
V
 
E
D
 
A
I
 
V
E
 
R
L
 
R
V
 
F
E
 
H
R
 
A
H
 
E
L
 
V
G
 
G
F
 
D
P
 
C
V
 
I
V
x
Y
I
x
K
K
x
P
T
 
V
L
 
A
S
 
G
G
|
G
S
x
A
Q
 
R
G
x
T
S
x
R
G
 
K
V
 
-
F
 
-
L
 
L
S
 
E
H
 
A
K
 
K
A
 
D
R
 
L
E
 
E
F
 
A
D
 
D
D
x
R
L
 
I
M
 
E
Q
 
R
L
 
L
I
 
-
E
 
-
A
 
-
T
 
-
N
 
-
K
 
S
N
 
A
A
 
A
N
 
P
I
 
V
I
 
C
L
 
F
Q
|
Q
E
|
E
F
 
L
I
x
L
A
 
T
N
 
-
S
 
-
H
 
-
G
 
G
R
 
D
D
|
D
L
 
V
R
|
R
V
 
V
F
 
Y
T
 
V
I
 
I
G
 
D
G
 
D
R
 
Q
V
 
V
A
 
I
G
 
C
C
 
A
Y
 
L
E
 
R
R
 
I
R
 
V
G
 
T
Q
 
D
E
 
E
D
 
I
S
 
D
F
 
F
K
 
R
A
 
-
N
 
-
V
 
-
S
 
Q
A
 
A
G
 
E
G
 
E
S
 
R
A
 
I
R
 
E
P
 
A
F
 
I
E
 
E
I
 
I
T
 
S
P
 
D
E
 
E
I
 
V
E
 
K
W
 
D
L
 
Q
A
 
C
T
 
V
Q
 
R
T
 
A
A
 
A
N
 
K
I
 
L
L
 
V
D
 
G
L
 
L
D
 
R
V
 
Y
A
 
T
G
 
G
I
 
M
D
 
D
L
 
I
L
x
K
F
 
A
D
 
G
-
 
A
N
 
D
G
 
G
H
 
N
Y
 
Y
K
 
R
I
 
V
C
x
L
E
|
E
A
 
L
N
 
N
S
 
A
S
|
S
P
 
A
G
x
M
F
 
F
E
 
R
G
 
G
L
 
F
E
 
E
S
 
G
C
 
R
L
 
A
N
 
N
V
 
V
D
 
D
I
 
I
A
 
C
A
 
G

Sites not aligning to the query:

7lg5A Synechocystis sp. Utex2470 cyanophycin synthetase 1 with atp (see paper)
24% identity, 38% coverage: 100:228/338 of query aligns to 213:330/871 of 7lg5A

query
sites
7lg5A
A
 
G
I
 
V
E
 
E
I
 
L
V
 
A
K
 
C
D
 
D
K
 
K
L
 
E
F
 
G
S
 
T
Q
 
K
Q
 
T
L
 
I
L
 
L
A
 
Q
E
 
D
K
 
A
N
 
G
L
 
I
P
 
P
T
 
V
P
 
P
K
 
R
T
 
G
M
 
T
L
 
T
V
 
I
K
 
Q
F
 
Y
P
 
F
V
 
D
D
 
D
I
 
L
E
 
E
-
 
E
L
 
A
V
 
I
E
 
N
R
 
D
H
 
V
L
 
G
G
 
G
F
 
Y
P
 
P
V
 
V
V
|
V
I
 
I
K
 
K
T
 
P
L
 
L
S
 
D
G
 
G
S
 
N
Q
 
H
G
 
G
S
 
R
G
 
G
V
 
I
F
 
T
L
 
I
S
 
N
H
 
-
K
 
-
A
 
V
R
 
R
E
 
H
F
 
W
D
 
Q
D
 
E
L
 
A
M
 
I
Q
 
A
L
 
A
I
 
Y
E
 
D
A
 
L
T
 
A
N
 
A
K
 
E
N
 
E
A
 
S
N
 
I
I
 
I
I
 
V
L
 
E
Q
 
R
E
 
Y
F
x
Y
I
 
-
A
 
-
N
 
-
S
 
-
H
 
E
G
 
G
R
 
S
D
|
D
L
 
H
R
 
R
V
 
V
F
 
L
T
 
V
I
 
V
G
 
N
G
 
G
R
 
K
V
 
L
A
 
V
G
 
A
C
 
V
Y
 
A
E
 
E
R
 
R
R
 
-
G
 
-
Q
 
-
E
 
-
D
 
-
S
 
-
F
 
I
K
 
P
A
 
A
N
 
H
V
 
V
S
 
T
A
 
G
G
 
D
G
 
G
S
 
S
A
 
S

Sites not aligning to the query:

3ax6A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima
33% identity, 23% coverage: 93:171/338 of query aligns to 86:158/360 of 3ax6A

query
sites
3ax6A
Y
 
Y
C
 
K
L
 
I
N
 
H
P
 
P
S
 
S
K
 
P
-
 
Y
A
 
T
I
 
L
E
 
E
I
 
I
V
 
I
K
 
Q
D
 
D
K
|
K
L
 
F
F
 
V
S
 
Q
Q
 
K
Q
 
E
L
 
F
L
 
L
A
 
K
E
 
K
K
 
N
N
 
G
L
 
I
P
 
P
T
 
V
P
 
P
K
 
E
T
 
Y
M
 
K
L
 
L
V
 
V
K
 
K
F
 
-
P
 
-
V
 
-
D
 
D
I
 
L
E
 
E
L
 
S
V
 
D
E
 
V
R
 
R
H
 
E
L
 
F
G
 
G
F
 
F
P
 
P
V
 
V
V
|
V
I
 
Q
K
|
K
T
 
A
L
 
R
S
 
K
G
 
G
S
 
-
Q
 
-
G
 
-
S
 
-
G
 
G
V
 
V
F
 
F
L
 
I
S
 
I
H
 
K
K
 
N
A
 
E
R
 
K
E
 
D
F
 
L
D
 
E
D
 
N
L
 
A
M
 
I
Q
 
K

Sites not aligning to the query:

Query Sequence

>7025244 FitnessBrowser__ANA3:7025244
MRGWILYKETATQLKPELYEIERLLAAAKADNIELEVYAPDEFDLTVTREDNKSILLNGQ
PVELPDFIIPRMGSGTTYFALAIIRHLERLGVYCLNPSKAIEIVKDKLFSQQLLAEKNLP
TPKTMLVKFPVDIELVERHLGFPVVIKTLSGSQGSGVFLSHKAREFDDLMQLIEATNKNA
NIILQEFIANSHGRDLRVFTIGGRVAGCYERRGQEDSFKANVSAGGSARPFEITPEIEWL
ATQTANILDLDVAGIDLLFDNGHYKICEANSSPGFEGLESCLNVDIAAQILHFIRIRLGM
FNKDEKSSESTPAQMAAPEVSSATNTSASTPTANTHSK

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory