SitesBLAST
Comparing 7025244 Shewana3_2405 alpha-L-glutamate ligase (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qyrD Crystal structure of rimk from pseudomonas aeruginosa pao1 (see paper)
36% identity, 83% coverage: 16:294/338 of query aligns to 10:286/293 of 7qyrD
- binding adenosine-5'-diphosphate: V139 (= V145), Y179 (≠ F187), I180 (= I188), D187 (= D195), R211 (≠ K219), S212 (≠ A220), L250 (= L258), M259 (≠ C267)
- binding : L12 (= L18), S14 (≠ E20), R64 (= R71), R189 (= R197), N262 (= N270), S264 (= S272), G266 (= G274)
Sites not aligning to the query:
4iwxA Rimk structure at 2.85a (see paper)
35% identity, 82% coverage: 18:294/338 of query aligns to 14:288/294 of 4iwxA
- binding adenosine-5'-diphosphate: V141 (= V145), K143 (= K147), E180 (= E186), Y181 (≠ F187), I182 (= I188), K183 (≠ A189), D189 (= D195), R213 (≠ K219), S214 (≠ A220), N215 (= N221), M261 (≠ C267), E262 (= E268)
- binding glutamic acid: R98 (≠ I103), R104 (≠ F109), Q107 (= Q112), L108 (= L113), R111 (≠ E116)
5zctH The crystal structure of the poly-alpha-l-glutamate peptides synthetase rimk at 2.05 angstrom resolution. (see paper)
35% identity, 82% coverage: 18:294/338 of query aligns to 12:286/292 of 5zctH
- binding phosphoaminophosphonic acid-adenylate ester: V139 (= V145), K141 (= K147), Q177 (= Q185), Y179 (≠ F187), I180 (= I188), D187 (= D195), F210 (= F218), R211 (≠ K219), S212 (≠ A220), N213 (= N221), R216 (≠ A224), L250 (= L258), M259 (≠ C267), E260 (= E268)
- binding magnesium ion: D248 (= D256), E260 (= E268)
5zctA The crystal structure of the poly-alpha-l-glutamate peptides synthetase rimk at 2.05 angstrom resolution. (see paper)
35% identity, 82% coverage: 18:294/338 of query aligns to 12:286/292 of 5zctA
- binding phosphoaminophosphonic acid-adenylate ester: K100 (= K107), K141 (= K147), T146 (≠ S152), Q147 (= Q153), G148 (= G154), Q177 (= Q185), Y179 (≠ F187), I180 (= I188), R211 (≠ K219), S212 (≠ A220), N213 (= N221), L250 (= L258), M259 (≠ C267)
3vpbB Argx from sulfolobus tokodaii complexed with lysw/glu/adp/mg/zn/sulfate (see paper)
27% identity, 65% coverage: 76:295/338 of query aligns to 56:277/282 of 3vpbB
- binding adenosine-5'-diphosphate: K87 (= K107), I125 (≠ V145), K127 (= K147), S132 (= S152), G134 (= G154), V137 (= V157), Q167 (= Q185), Y169 (≠ F187), I170 (= I188), D176 (= D195), R200 (≠ K219), A201 (= A220), N202 (= N221), N249 (≠ C267), E250 (= E268)
- binding glutamic acid: Y190 (= Y209), R192 (= R211), N202 (= N221), V203 (= V222), A204 (≠ S223), E256 (≠ G274), G259 (= G277)
- binding magnesium ion: D237 (= D256), E250 (= E268)
- binding zinc ion: E250 (= E268), N252 (= N270)
Q970U6 Glutamate--LysW ligase ArgX; EC 6.3.2.- from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
27% identity, 65% coverage: 76:295/338 of query aligns to 56:277/282 of Q970U6
- D237 (= D256) binding
- E250 (= E268) binding ; binding
- N252 (= N270) binding
Q4JAP9 Alpha-aminoadipate--LysW ligase LysX; AAA--LysW ligase LysX; EC 6.3.2.43 from Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) (see paper)
30% identity, 68% coverage: 66:295/338 of query aligns to 43:271/276 of Q4JAP9
- NT 253:254 (≠ GL 277:278) mutation to GF: Alters substrate specificity, so that glutamate is preferred over alpha-aminoadipate.
3vpdA Lysx from thermus thermophilus complexed with amp-pnp (see paper)
29% identity, 63% coverage: 81:293/338 of query aligns to 63:274/281 of 3vpdA
- binding phosphoaminophosphonic acid-adenylate ester: V127 (= V145), K129 (= K147), W135 (≠ Q153), G136 (= G154), L139 (≠ V157), Q169 (= Q185), V172 (≠ I188), K174 (≠ S191), D178 (= D195), R194 (≠ E210), W199 (≠ F218), T201 (≠ A220), F239 (≠ L258), E249 (= E268)
- binding butanoic acid: F256 (= F275), K257 (≠ E276), N258 (≠ G277), S259 (≠ L278)
5k2mI Bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma- aaa (see paper)
27% identity, 63% coverage: 80:293/338 of query aligns to 56:266/273 of 5k2mI
- binding adenosine-5'-diphosphate: K83 (= K107), V120 (= V145), K122 (= K147), S127 (= S152), L132 (≠ S160), Q162 (= Q185), V165 (≠ I188), K167 (≠ N190), D171 (= D195), W192 (≠ F218), I193 (≠ K219), T194 (≠ A220), N195 (= N221), F231 (≠ L258), N240 (≠ C267), E241 (= E268)
- binding 2-aminohexanedioic acid: R173 (= R197), N195 (= N221), T196 (≠ V222), A197 (≠ S223), E247 (≠ G274), F248 (= F275), N250 (≠ G277)
- binding : F125 (≠ S150), W128 (≠ Q153), R130 (≠ S155), N153 (= N181), Y156 (vs. gap), N245 (≠ S272)
Sites not aligning to the query:
5k2mG Bifunctional lysx/argx from thermococcus kodakarensis with lysw-gamma- aaa (see paper)
27% identity, 63% coverage: 80:293/338 of query aligns to 56:266/273 of 5k2mG
- binding adenosine-5'-diphosphate: K83 (= K107), V120 (= V145), K122 (= K147), S127 (= S152), G129 (= G154), Q162 (= Q185), V165 (≠ I188), K167 (≠ N190), D171 (= D195), W192 (≠ F218), T194 (≠ A220), N195 (= N221), F231 (≠ L258), N240 (≠ C267), E241 (= E268)
- binding magnesium ion: D229 (= D256), E241 (= E268)
- binding : F125 (≠ S150), S127 (= S152), W128 (≠ Q153), R130 (≠ S155), Y156 (vs. gap), R173 (= R197), R187 (= R211), T196 (≠ V222), A197 (≠ S223), N243 (= N270), P244 (≠ S271), N245 (≠ S272), E247 (≠ G274), F248 (= F275), N250 (≠ G277), A251 (≠ L278)
Sites not aligning to the query:
1uc9A Crystal structure of a lysine biosynthesis enzyme, lysx, from thermus thermophilus hb8 (see paper)
24% identity, 71% coverage: 55:293/338 of query aligns to 37:250/256 of 1uc9A
7waeB Trichodesmium erythraeum cyanophycin synthetase 1 (tecpha1) with atpgammas, 4x(beta-asp-arg), and aspartate (see paper)
25% identity, 33% coverage: 100:211/338 of query aligns to 213:323/877 of 7waeB
Sites not aligning to the query:
- binding phosphothiophosphoric acid-adenylate ester: 450, 497, 498, 499, 500, 558, 692, 696, 731, 745, 746, 748, 752, 755
- binding magnesium ion: 431, 450, 500, 522, 558
- binding : 166, 454, 455, 456
7waeD Trichodesmium erythraeum cyanophycin synthetase 1 (tecpha1) with atpgammas, 4x(beta-asp-arg), and aspartate (see paper)
25% identity, 33% coverage: 100:211/338 of query aligns to 213:323/724 of 7waeD
- binding phosphothiophosphoric acid-adenylate ester: K220 (= K107), V259 (= V145), K261 (= K147), G265 (= G151), N266 (≠ S152), H267 (≠ Q153), G268 (= G154), I271 (≠ V157), I273 (≠ L159), E300 (≠ Q185), Y303 (≠ I188), D307 (= D195)
- binding arginine: N266 (≠ S152)
- binding magnesium ion: N266 (≠ S152)
- binding : R309 (= R197)
Sites not aligning to the query:
- binding phosphothiophosphoric acid-adenylate ester: 450, 497, 498, 499, 500, 501, 558, 692, 696
- binding arginine: 164, 165, 453
- binding aspartic acid: 394, 458
- binding magnesium ion: 431, 450, 450, 452, 500, 522
- binding : 455, 456
7lgmA Cyanophycin synthetase from a. Baylyi dsm587 with atp (see paper)
31% identity, 33% coverage: 100:211/338 of query aligns to 211:318/719 of 7lgmA
Sites not aligning to the query:
7txuA Cyanophycin synthetase 1 from synechocystis sp. Utex2470 with atp and 16x(asp-arg)
25% identity, 38% coverage: 100:228/338 of query aligns to 213:331/869 of 7txuA
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 494, 495, 496, 497, 519, 689, 693, 742, 749
- binding magnesium ion: 497, 519, 555
- binding zinc ion: 59, 79, 83
- binding : 14, 16, 17, 18, 19, 57, 58, 86, 87, 90, 96, 97, 99, 100, 164, 165, 166, 202, 203, 450, 597, 604
7lgjA Cyanophycin synthetase 1 from synechocystis sp. Utex2470 with adpcp and 8x(asp-arg)-nh2 (see paper)
25% identity, 38% coverage: 100:228/338 of query aligns to 213:331/869 of 7lgjA
Sites not aligning to the query:
- binding phosphomethylphosphonic acid adenylate ester: 494, 495, 496, 497, 498, 693, 728, 742
- binding magnesium ion: 428, 447, 497, 519, 555
- binding : 164, 165, 166, 187, 202, 203, 450, 453
7drpA Structure of atp-grasp ligase psnb complexed with phosphomimetic variant of minimal precursor, mg, and adp (see paper)
25% identity, 61% coverage: 82:288/338 of query aligns to 107:300/312 of 7drpA
- binding adenosine-5'-diphosphate: K170 (≠ I146), T178 (≠ G154), Q202 (= Q185), E203 (= E186), L205 (≠ I188), D209 (= D195), K269 (≠ L258), L279 (≠ C267), E280 (= E268)
- binding magnesium ion: D267 (= D256), E280 (= E268), E280 (= E268), N282 (= N270)
- binding : Y169 (≠ V145), G175 (= G151), A176 (≠ S152), R179 (≠ S155), R190 (≠ D168), R193 (≠ Q171), L194 (= L172), V199 (≠ I182), R211 (= R197), N282 (= N270), S284 (= S272), A285 (≠ P273), M286 (≠ G274)
Sites not aligning to the query:
7drnA Structure of atp-grasp ligase psnb complexed with precursor peptide psna2 and amppnp (see paper)
25% identity, 61% coverage: 82:288/338 of query aligns to 107:300/311 of 7drnA
- binding phosphoaminophosphonic acid-adenylate ester: K170 (≠ I146), T178 (≠ G154), Q202 (= Q185), E203 (= E186), L205 (≠ I188), D209 (= D195), K269 (≠ L258), L279 (≠ C267), E280 (= E268)
- binding : Y169 (≠ V145), P171 (≠ K147), G175 (= G151), A176 (≠ S152), R179 (≠ S155), R190 (≠ D168), R211 (= R197), S284 (= S272), M286 (≠ G274)
Sites not aligning to the query:
7lg5A Synechocystis sp. Utex2470 cyanophycin synthetase 1 with atp (see paper)
24% identity, 38% coverage: 100:228/338 of query aligns to 213:330/871 of 7lg5A
Sites not aligning to the query:
3ax6A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima
33% identity, 23% coverage: 93:171/338 of query aligns to 86:158/360 of 3ax6A
Sites not aligning to the query:
Query Sequence
>7025244 Shewana3_2405 alpha-L-glutamate ligase (RefSeq)
MRGWILYKETATQLKPELYEIERLLAAAKADNIELEVYAPDEFDLTVTREDNKSILLNGQ
PVELPDFIIPRMGSGTTYFALAIIRHLERLGVYCLNPSKAIEIVKDKLFSQQLLAEKNLP
TPKTMLVKFPVDIELVERHLGFPVVIKTLSGSQGSGVFLSHKAREFDDLMQLIEATNKNA
NIILQEFIANSHGRDLRVFTIGGRVAGCYERRGQEDSFKANVSAGGSARPFEITPEIEWL
ATQTANILDLDVAGIDLLFDNGHYKICEANSSPGFEGLESCLNVDIAAQILHFIRIRLGM
FNKDEKSSESTPAQMAAPEVSSATNTSASTPTANTHSK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory