SitesBLAST
Comparing 7025360 Shewana3_2520 aminotransferase (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P12995 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Escherichia coli (strain K12) (see 4 papers)
60% identity, 93% coverage: 6:426/452 of query aligns to 5:419/429 of P12995
- Y17 (= Y18) mutation to F: Severely reduces the aminotransferase activity.
- W52 (= W53) binding
- GS 112:113 (= GS 113:114) binding
- Y144 (= Y151) mutation to F: Severely reduces the aminotransferase activity.
- D147 (= D154) mutation to N: Loss of aminotransferase activity.
- D245 (= D252) binding
- R253 (= R260) mutation to A: Has only a small effect on the rate of reaction with DAPA.; mutation to K: Increases aminotransferase activity toward SAM.; mutation to M: Loss of aminotransferase activity.; mutation to Q: Increases aminotransferase activity toward SAM.
- K274 (= K281) binding ; modified: N6-(pyridoxal phosphate)lysine
- G307 (= G314) binding
- PT 308:309 (= PT 315:316) binding
- R391 (= R398) binding ; mutation to A: Reduces aminotransferase activity.
6ed7A Crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
60% identity, 93% coverage: 6:426/452 of query aligns to 5:419/429 of 6ed7A
- active site: Y17 (= Y18), Y144 (= Y151), D245 (= D252), K274 (= K281)
- binding 2-[(2-nitrophenyl)sulfanyl]acetohydrazide: Y17 (= Y18), W52 (= W53), W52 (= W53), Y144 (= Y151), D147 (= D154), A217 (= A224), K274 (= K281), R391 (= R398), F393 (= F400), F393 (= F400)
- binding pyridoxal-5'-phosphate: G112 (= G113), S113 (= S114), Y144 (= Y151), H145 (= H152), D245 (= D252), I247 (= I254), K274 (= K281)
1mlzA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the trans-isomer of amiclenomycin. (see paper)
60% identity, 93% coverage: 6:426/452 of query aligns to 5:418/427 of 1mlzA
- active site: Y17 (= Y18), Y144 (= Y151), E210 (= E218), D244 (= D252), A247 (= A255), K273 (= K281), Y397 (= Y405)
- binding pyridoxal-5'-phosphate: G112 (= G113), S113 (= S114), Y144 (= Y151), H145 (= H152), D244 (= D252), I246 (= I254), K273 (= K281), P307 (= P315), T308 (= T316)
- binding trans-amiclenomycin: W52 (= W53), W53 (= W54), Y144 (= Y151), K273 (= K281), R390 (= R398), F392 (= F400)
1mlyA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin (see paper)
60% identity, 93% coverage: 6:426/452 of query aligns to 5:418/427 of 1mlyA
- active site: Y17 (= Y18), Y144 (= Y151), E210 (= E218), D244 (= D252), A247 (= A255), K273 (= K281), Y397 (= Y405)
- binding cis-amiclenomycin: W52 (= W53), W53 (= W54), K273 (= K281), R390 (= R398), F392 (= F400)
- binding pyridoxal-5'-phosphate: G112 (= G113), S113 (= S114), Y144 (= Y151), H145 (= H152), D244 (= D252), I246 (= I254), K273 (= K281), P307 (= P315), T308 (= T316)
1dtyA Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor.
59% identity, 93% coverage: 6:426/452 of query aligns to 5:419/429 of 1dtyA
- active site: Y17 (= Y18), Y144 (= Y151), E211 (= E218), D245 (= D252), A248 (= A255), K274 (= K281), Y398 (= Y405)
- binding pyridoxal-5'-phosphate: G112 (= G113), S113 (= S114), Y144 (= Y151), H145 (= H152), D245 (= D252), I247 (= I254), K274 (= K281)
1qj3A Crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid (see paper)
59% identity, 93% coverage: 6:426/452 of query aligns to 5:407/416 of 1qj3A
- active site: Y17 (= Y18), Y144 (= Y151), E201 (= E218), D235 (= D252), A238 (= A255), K264 (= K281), Y386 (= Y405)
- binding 7-keto-8-aminopelargonic acid: Y17 (= Y18), W52 (= W53), Y144 (= Y151), K264 (= K281), R379 (= R398), F381 (= F400)
- binding pyridoxal-5'-phosphate: G112 (= G113), S113 (= S114), Y144 (= Y151), H145 (= H152), G146 (= G153), D235 (= D252), I237 (= I254), A238 (= A255), K264 (= K281)
6erkA Crystal structure of diaminopelargonic acid aminotransferase from psychrobacter cryohalolentis (see paper)
52% identity, 94% coverage: 8:430/452 of query aligns to 8:415/420 of 6erkA
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
51% identity, 93% coverage: 10:428/452 of query aligns to 10:420/425 of 4w1vA
- active site: Y18 (= Y18), Y147 (= Y151), E210 (= E218), D244 (= D252), A247 (= A255), K273 (= K281), Y397 (= Y405)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P17), Y18 (= Y18), W54 (= W53), M81 (= M80), G83 (= G82), Y147 (= Y151), G306 (= G314), P307 (= P315), T308 (= T316), F392 (= F400)
- binding pyridoxal-5'-phosphate: G114 (= G113), S115 (= S114), Y147 (= Y151), H148 (= H152), E210 (= E218), D244 (= D252), I246 (= I254), K273 (= K281)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
51% identity, 93% coverage: 10:428/452 of query aligns to 10:420/425 of 4cxrA
- active site: Y18 (= Y18), Y147 (= Y151), E210 (= E218), D244 (= D252), A247 (= A255), K273 (= K281), Y397 (= Y405)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (= Y18), W54 (= W53), W55 (= W54), A216 (= A224)
- binding pyridoxal-5'-phosphate: G114 (= G113), S115 (= S114), Y147 (= Y151), H148 (= H152), E210 (= E218), D244 (= D252), I246 (= I254), K273 (= K281), P307 (= P315), T308 (= T316)
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
51% identity, 93% coverage: 10:428/452 of query aligns to 10:422/427 of 4cxqA
- active site: Y18 (= Y18), Y149 (= Y151), E212 (= E218), D246 (= D252), A249 (= A255), K275 (= K281), Y399 (= Y405)
- binding 7-keto-8-aminopelargonic acid: W56 (= W53), Y149 (= Y151), G308 (= G314), T310 (= T316), R392 (= R398)
- binding pyridoxal-5'-phosphate: G116 (= G113), S117 (= S114), Y149 (= Y151), H150 (= H152), G151 (= G153), E212 (= E218), D246 (= D252), I248 (= I254), K275 (= K281), P309 (= P315), T310 (= T316)
P9WQ81 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; 7,8-diaminopelargonic acid synthase; DAPAS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
50% identity, 93% coverage: 10:428/452 of query aligns to 17:430/437 of P9WQ81
- Y25 (= Y18) mutation to A: Does not show detectable activity at 335 nm with SAM, even up to concentrations of 3 mM, and shows approximately 70% reduced activity with high concentrations of DAPA (0.5 mM).
- W64 (= W53) binding
- Y157 (= Y151) binding
- K283 (= K281) modified: N6-(pyridoxal phosphate)lysine
- G316 (= G314) binding
5te2A Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a mechanism-based inhibitor (see paper)
50% identity, 93% coverage: 10:428/452 of query aligns to 10:423/428 of 5te2A
- active site: Y18 (= Y18), Y150 (= Y151), E213 (= E218), D247 (= D252), A250 (= A255), K276 (= K281), Y400 (= Y405)
- binding [5-hydroxy-4-({[6-(3-hydroxypropyl)-4-oxo-1,4-dihydropyridin-3-yl]amino}methyl)-6-methylpyridin-3-yl]methyl dihydrogen phosphate: Y18 (= Y18), W57 (= W53), G117 (= G113), S118 (= S114), Y150 (= Y151), H151 (= H152), G152 (= G153), D247 (= D252), I249 (= I254), K276 (= K281), G309 (= G314), P310 (= P315), T311 (= T316)
4xjoA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead (see paper)
50% identity, 93% coverage: 10:428/452 of query aligns to 10:423/428 of 4xjoA
- active site: Y18 (= Y18), Y150 (= Y151), E213 (= E218), D247 (= D252), A250 (= A255), K276 (= K281), Y400 (= Y405)
- binding 5-[4-(3-chlorobenzoyl)piperazin-1-yl]-1H-inden-1-one: P17 (= P17), Y18 (= Y18), W57 (= W53), M84 (= M80), G86 (= G82), Y150 (= Y151), G165 (= G166), G166 (= G167), A219 (= A224), P310 (= P315), T311 (= T316)
- binding pyridoxal-5'-phosphate: G117 (= G113), S118 (= S114), Y150 (= Y151), H151 (= H152), G152 (= G153), E213 (= E218), D247 (= D252), I249 (= I254), K276 (= K281), P310 (= P315), T311 (= T316)
4xewA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound (see paper)
50% identity, 93% coverage: 10:428/452 of query aligns to 10:423/428 of 4xewA
- active site: Y18 (= Y18), Y150 (= Y151), E213 (= E218), D247 (= D252), A250 (= A255), K276 (= K281), Y400 (= Y405)
- binding 6-(2-fluorophenyl)[1,3]dioxolo[4,5-g]quinolin-8(5H)-one: P17 (= P17), Y18 (= Y18), W57 (= W53), Y150 (= Y151), P310 (= P315), T311 (= T316), R393 (= R398), F395 (= F400)
- binding pyridoxal-5'-phosphate: G117 (= G113), S118 (= S114), Y150 (= Y151), H151 (= H152), G152 (= G153), E213 (= E218), D247 (= D252), I249 (= I254), K276 (= K281), P310 (= P315), T311 (= T316)
4wyfA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a dsf fragment hit (see paper)
50% identity, 93% coverage: 10:428/452 of query aligns to 10:423/428 of 4wyfA
- active site: Y18 (= Y18), Y150 (= Y151), E213 (= E218), D247 (= D252), A250 (= A255), K276 (= K281), Y400 (= Y405)
- binding N-(1-oxo-1H-inden-5-yl)acetamide: M84 (= M80), G86 (= G82), G309 (= G314), P310 (= P315), T311 (= T316)
- binding pyridoxal-5'-phosphate: G117 (= G113), S118 (= S114), Y150 (= Y151), H151 (= H152), G152 (= G153), E213 (= E218), D247 (= D252), I249 (= I254), K276 (= K281), P310 (= P315), T311 (= T316)
4wycA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole benzamide inhibitor (see paper)
50% identity, 93% coverage: 10:428/452 of query aligns to 10:423/428 of 4wycA
- active site: Y18 (= Y18), Y150 (= Y151), E213 (= E218), D247 (= D252), A250 (= A255), K276 (= K281), Y400 (= Y405)
- binding 4-(1H-imidazol-1-yl)benzamide: P17 (= P17), Y18 (= Y18), W57 (= W53), M84 (= M80), G86 (= G82), Y150 (= Y151), G309 (= G314)
- binding pyridoxal-5'-phosphate: G117 (= G113), S118 (= S114), Y150 (= Y151), H151 (= H152), G152 (= G153), E213 (= E218), D247 (= D252), I249 (= I254), K276 (= K281), P310 (= P315), T311 (= T316)
4mqrA Mycobaterium tuberculosis transaminase bioa complexed with e)-5- hydroxy-4-(((z)-isonicotinoyldiazenyl)methylene)-6-methyl-1,4- dihydropyridin-3-yl)methyl phosphate (see paper)
50% identity, 93% coverage: 10:428/452 of query aligns to 10:423/428 of 4mqrA
- active site: Y18 (= Y18), Y150 (= Y151), E213 (= E218), D247 (= D252), A250 (= A255), K276 (= K281), Y400 (= Y405)
- binding [(4Z)-5-hydroxy-6-methyl-4-{[(E)-(pyridin-4-ylcarbonyl)diazenyl]methylidene}-1,4-dihydropyridin-3-yl]methyl dihydrogen phosphate: Y18 (= Y18), W57 (= W53), G117 (= G113), S118 (= S114), Y150 (= Y151), H151 (= H152), D247 (= D252), I249 (= I254), K276 (= K281), G309 (= G314), P310 (= P315), T311 (= T316)
4mqqA Mycobaterium tuberculosis transaminase bioa complexed with benzo[d]thiazole-2-carbohydrazide (see paper)
50% identity, 93% coverage: 10:428/452 of query aligns to 10:423/428 of 4mqqA
- active site: Y18 (= Y18), Y150 (= Y151), E213 (= E218), D247 (= D252), A250 (= A255), K276 (= K281), Y400 (= Y405)
- binding (4-{[(E)-(1,3-benzothiazol-2-ylcarbonyl)diazenyl]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: Y18 (= Y18), W57 (= W53), W58 (= W54), G117 (= G113), S118 (= S114), Y150 (= Y151), H151 (= H152), D247 (= D252), I249 (= I254), K276 (= K281), P310 (= P315), T311 (= T316)
4mqpA Mycobaterium tuberculosis transaminase bioa complexed with 2- hydrazinylbenzo[d]thiazole (see paper)
50% identity, 93% coverage: 10:428/452 of query aligns to 10:423/428 of 4mqpA
- active site: Y18 (= Y18), Y150 (= Y151), E213 (= E218), D247 (= D252), A250 (= A255), K276 (= K281), Y400 (= Y405)
- binding (4-{[(E)-1,3-benzothiazol-2-yldiazenyl]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: W57 (= W53), W58 (= W54), G117 (= G113), S118 (= S114), Y150 (= Y151), H151 (= H152), E213 (= E218), A219 (= A224), D247 (= D252), I249 (= I254), K276 (= K281), Y400 (= Y405)
4wydA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase from mycobacterium tuberculosis complexed with a fragment from dsf screening (see paper)
50% identity, 93% coverage: 10:428/452 of query aligns to 10:423/430 of 4wydA
- active site: Y18 (= Y18), Y150 (= Y151), E213 (= E218), D247 (= D252), A250 (= A255), K276 (= K281), Y400 (= Y405)
- binding N-methyl-1-[4-(1H-pyrazol-1-ylmethyl)phenyl]methanamine: Y18 (= Y18), W57 (= W53), W58 (= W54), Y150 (= Y151), A219 (= A224), G309 (= G314), T311 (= T316), F395 (= F400)
- binding pyridoxal-5'-phosphate: G117 (= G113), S118 (= S114), Y150 (= Y151), H151 (= H152), E213 (= E218), D247 (= D252), I249 (= I254), K276 (= K281), P310 (= P315), T311 (= T316)
Query Sequence
>7025360 Shewana3_2520 aminotransferase (RefSeq)
MRNLLDLDFDSAHIWHPYTSMTRALPVYGVHSAQGCELELVDGRKLIDGTSSWWACVHGY
GHPAILTAMERQLHQLSHVMFGGITHEPAITLCKKLLAMTCEPLTKVFLCDSGSIAVEVA
IKMALQYWQGQDLPLAQKAQKQRILTVKKGYHGDTFAAMSVCDPEGGMHTMFGEAVTKQC
FVDAPQTPFGEPLRQDDLAPMQRILREQHPEIAAVIIEPIMQGAGGMRFYSSEYLRGLRA
LCDEYNVLLILDEIATGFGRTGKLFAYEHADITPDILCLGKALTGGYISLAATLCTDNVA
QGISQSPAGVFMHGPTFMGNPLACAAACASLDLINQQEWPAQVAAIEQQMQRELADAIDI
PSVKEVRVLGAVGVLEMHQAVNTAALQQQFVDLGVWVRPFANLIYIMPPYVISSSQLTRL
TQAMKQVAATIAPPHANQSEALVTESITISHG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory