Comparing 7025500 FitnessBrowser__ANA3:7025500 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8j5qD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- translocation state (see paper)
45% identity, 84% coverage: 33:251/261 of query aligns to 379:599/611 of 8j5qD
Sites not aligning to the query:
8j5tD Cryo-em structure of mycobacterium tuberculosis oppabcd in the catalytic intermediate state (see paper)
45% identity, 84% coverage: 33:251/261 of query aligns to 379:599/608 of 8j5tD
Sites not aligning to the query:
8j5sD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- catalytic intermediate state (see paper)
45% identity, 84% coverage: 33:251/261 of query aligns to 379:599/608 of 8j5sD
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 95% coverage: 5:253/261 of query aligns to 1:238/240 of 4ymuJ
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
33% identity, 95% coverage: 4:251/261 of query aligns to 2:244/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
33% identity, 95% coverage: 4:251/261 of query aligns to 2:244/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
33% identity, 95% coverage: 4:251/261 of query aligns to 2:244/250 of 7z16I
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
31% identity, 95% coverage: 4:252/261 of query aligns to 2:260/330 of P0AAH4
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 95% coverage: 5:252/261 of query aligns to 1:242/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 95% coverage: 5:252/261 of query aligns to 2:243/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 95% coverage: 5:252/261 of query aligns to 2:243/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 95% coverage: 5:252/261 of query aligns to 2:243/344 of 3tuiC
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 95% coverage: 4:252/261 of query aligns to 1:237/241 of 4u00A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 98% coverage: 3:257/261 of query aligns to 15:254/378 of P69874
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 87% coverage: 28:253/261 of query aligns to 17:240/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 87% coverage: 28:253/261 of query aligns to 17:240/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 87% coverage: 28:253/261 of query aligns to 17:240/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 87% coverage: 28:253/261 of query aligns to 17:240/242 of 2oljA
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
32% identity, 85% coverage: 34:255/261 of query aligns to 46:267/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
32% identity, 85% coverage: 34:255/261 of query aligns to 46:267/382 of 7aheC
Sites not aligning to the query:
>7025500 FitnessBrowser__ANA3:7025500
MTTPLLKVNDLFKRYDTGYKGFTRQYNDALAPVSFELNRGETLAIVGEAGSGKSTLARIL
VGAEPRSGGEIYFEGEALDSRNIKQRCRLIRMIFQDPNTSLNPRLTIGQLLDEPLRFNTE
LSAKERSGQVIDTLRKVGLLPEHADFYPHMISEGQKQRVAVARALMLNPKIIIADEALTA
LDLSVRSQILNLLLKLQKDLGLSYIFVSHNLNIIRHVSDKIMVLHKGVMVEKAPTEQIFN
SPQHEYTQRLIQEQSLFVHKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory