Comparing 7025556 FitnessBrowser__ANA3:7025556 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q96G03 Phosphopentomutase; Glucose phosphomutase 2; Phosphodeoxyribomutase; Phosphoglucomutase-2; EC 5.4.2.7; EC 5.4.2.2 from Homo sapiens (Human) (see 2 papers)
37% identity, 94% coverage: 2:542/573 of query aligns to 12:575/612 of Q96G03
Sites not aligning to the query:
O74478 Probable phosphoribomutase; PRM; Phosphoglucomutase 3 homolog; PGM 3 homolog; EC 5.4.2.7 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
39% identity, 96% coverage: 1:552/573 of query aligns to 1:565/587 of O74478
P18159 Phosphoglucomutase; PGM; Alpha-phosphoglucomutase; Glucose phosphomutase; EC 5.4.2.2 from Bacillus subtilis (strain 168) (see paper)
36% identity, 89% coverage: 32:539/573 of query aligns to 29:549/581 of P18159
Q03262 Phosphoribomutase; PRM; Phosphoglucomutase 3; PGM 3; EC 5.4.2.7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
35% identity, 97% coverage: 3:557/573 of query aligns to 11:602/622 of Q03262
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
26% identity, 88% coverage: 43:549/573 of query aligns to 2:443/455 of 1wqaA
7p5oB Crystal structure of aspergillus fumigatus phosphoglucomutase in complex with the reaction intermediate
24% identity, 85% coverage: 79:564/573 of query aligns to 44:549/558 of 7p5oB
Sites not aligning to the query:
P31120 Phosphoglucosamine mutase; EC 5.4.2.10 from Escherichia coli (strain K12) (see 3 papers)
27% identity, 55% coverage: 41:358/573 of query aligns to 1:290/445 of P31120
7omlA Bacillus subtilis phosphoglucomutase glmm (metal bound) (see paper)
25% identity, 86% coverage: 47:538/573 of query aligns to 4:422/445 of 7omlA
7ojrA Bacillus subtilis phosphoglucomutase glmm (phosphate bound) (see paper)
25% identity, 86% coverage: 47:538/573 of query aligns to 4:422/445 of 7ojrA
2fuvA Phosphoglucomutase from salmonella typhimurium.
24% identity, 86% coverage: 45:538/573 of query aligns to 39:519/545 of 2fuvA
3i3wA Structure of a phosphoglucosamine mutase from francisella tularensis
27% identity, 51% coverage: 47:337/573 of query aligns to 3:265/441 of 3i3wA
Sites not aligning to the query:
3pmgA Structure of rabbit muscle phosphoglucomutase at 2.4 angstroms resolution. Use of freezing point depressant and reduced temperature to enhance diffractivity (see paper)
25% identity, 70% coverage: 48:448/573 of query aligns to 17:420/561 of 3pmgA
1c4gA Phosphoglucomutase vanadate based transition state analog complex
25% identity, 70% coverage: 48:448/573 of query aligns to 17:420/561 of 1c4gA
Sites not aligning to the query:
1c47A Binding driven structural changes in crystaline phosphoglucomutase associated with chemical reaction
25% identity, 70% coverage: 48:448/573 of query aligns to 17:420/561 of 1c47A
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
25% identity, 47% coverage: 47:313/573 of query aligns to 6:242/455 of 2h5aX
Sites not aligning to the query:
2h4lX Complex of pmm/pgm with ribose 1-phosphate (see paper)
25% identity, 47% coverage: 47:313/573 of query aligns to 6:242/455 of 2h4lX
Sites not aligning to the query:
2fkfA Phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound (see paper)
25% identity, 47% coverage: 47:313/573 of query aligns to 6:242/455 of 2fkfA
Sites not aligning to the query:
1pcmX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
25% identity, 47% coverage: 47:313/573 of query aligns to 6:242/455 of 1pcmX
Sites not aligning to the query:
1p5gX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
25% identity, 47% coverage: 47:313/573 of query aligns to 6:242/455 of 1p5gX
Sites not aligning to the query:
1p5dX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
25% identity, 47% coverage: 47:313/573 of query aligns to 6:242/455 of 1p5dX
Sites not aligning to the query:
>7025556 FitnessBrowser__ANA3:7025556
MNTHLQLQVKHWLENDPDPRTQAQLQALIDAGNDAELEARFAGRLEFGTAGLRGVVGAGP
MGMNRLVIRQTSAGLGAYLLEQIKDAAERGVVIGYDGRHDSRTFAHDTASVLTAMGIKVR
LTAKVAPTPLVAFGVKHFNAAAGIVVTASHNPPQYNGYKVYWENGAQIIPPHDSGIAAKI
ELAATQAIPFMDQVEATKQGKLIWLQDDYYETYRRGVMHANVLQNNTAPEKVSLAYTAMH
GVGAEMAETVLKDAGFAQVYSVVAQREPDGDFPTVNFPNPEEKGAMDLVIAEAKKHGAML
ACANDPDADRFAVAVRKDDGEYQMLTGDQVGVLFGHYLLSHASKEQRLVGTTIVSSSLLS
KIAKGFGVESYTTLTGFKWLMNVGIAQSQPDNQFLFAYEEALGYTVGNMVWDKDGLSALV
AFAQLTAELAAKGQTIWDRLEQIYREQGFHLNAQVSIALKPDTPNIGAYLREHPPLAIGE
HALVSTDDLKALERRFADGKVEKINLPASDVLTYRLANGARVIVRPSGTEPKIKCYYEVV
EPMTAQDTLASAQARATLAMEAFISAHQASLPK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory