Comparing 7025707 FitnessBrowser__ANA3:7025707 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
34% identity, 86% coverage: 15:193/208 of query aligns to 17:213/224 of 3v77A
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
34% identity, 80% coverage: 16:182/208 of query aligns to 15:197/218 of 6fogA
Sites not aligning to the query:
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
35% identity, 80% coverage: 16:182/208 of query aligns to 14:196/216 of 6sbiA
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
34% identity, 80% coverage: 16:182/208 of query aligns to 20:202/224 of Q6P587
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
33% identity, 85% coverage: 3:179/208 of query aligns to 13:210/233 of 6j5yA
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
33% identity, 80% coverage: 15:181/208 of query aligns to 10:214/247 of 1nkqA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
35% identity, 79% coverage: 13:177/208 of query aligns to 68:245/277 of 6iymA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
29% identity, 80% coverage: 12:177/208 of query aligns to 66:247/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
29% identity, 80% coverage: 12:177/208 of query aligns to 66:247/280 of 6j5xA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
31% identity, 81% coverage: 11:179/208 of query aligns to 59:227/252 of 3qdfA
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
32% identity, 82% coverage: 13:182/208 of query aligns to 91:279/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
32% identity, 82% coverage: 13:182/208 of query aligns to 90:278/303 of 8skyB
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
28% identity, 84% coverage: 5:178/208 of query aligns to 61:247/279 of 6v77B
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
27% identity, 79% coverage: 14:177/208 of query aligns to 71:248/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
27% identity, 79% coverage: 14:177/208 of query aligns to 71:248/290 of 8gsrA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
26% identity, 79% coverage: 11:175/208 of query aligns to 59:242/269 of 4dbhA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
27% identity, 85% coverage: 1:177/208 of query aligns to 50:231/265 of 3r6oA
1gttA Crystal structure of hpce (see paper)
27% identity, 78% coverage: 16:177/208 of query aligns to 225:392/421 of 1gttA
>7025707 FitnessBrowser__ANA3:7025707
MKTVNVGDKQICPSKILCIGRNYVDHIHELGNDIPEDMVVFFKPNSAISTVLHAEHLGET
LHYETELCFIYQQGRFSHVGVGLDLTKRELQSKLKTKGLPWEKAKAFDGAALFSPFVAID
DASAAFEFSLTIDGALTQAGHIELMIYNPQTILEELQRFTTLEDGDIVMTGTPKGVGIIP
PNRVFKVALGLKDAPHQTPLVECEWQSR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory