SitesBLAST
Comparing 7025755 FitnessBrowser__ANA3:7025755 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
22% identity, 51% coverage: 42:514/934 of query aligns to 45:460/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ F70), G75 (≠ A72), S76 (≠ A73), G77 (= G74), T78 (= T75), G79 (≠ S76), L80 (= L77), A83 (≠ Q80), C84 (≠ A81), P137 (= P133), G138 (≠ A134), E139 (≠ T135), A142 (= A139), T143 (≠ M140), G146 (= G143), N147 (≠ I144), S149 (= S146), T150 (≠ N147), A152 (= A149), G153 (≠ S150), E203 (= E251), G204 (= G252), I209 (≠ V257), E422 (= E476), H423 (= H477)
- binding fe (iii) ion: H377 (= H431), H384 (= H438), E422 (= E476)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
25% identity, 50% coverage: 50:520/934 of query aligns to 48:458/459 of P9WIT1
- K354 (≠ I396) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
23% identity, 35% coverage: 192:518/934 of query aligns to 154:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E200 (= E251), G201 (= G252), I206 (≠ V257), W323 (≠ F382), E414 (= E476), H415 (= H477), N451 (= N513)
- binding manganese (ii) ion: H370 (= H431), H377 (= H438), E414 (= E476)
- binding pyruvic acid: R319 (= R378), H370 (= H431), H377 (= H438), H415 (= H477)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
23% identity, 35% coverage: 192:518/934 of query aligns to 154:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E200 (= E251), G201 (= G252), I206 (≠ V257), W322 (≠ F382), E413 (= E476), H414 (= H477), N450 (= N513)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R378), H369 (= H431), H376 (= H438), H414 (= H477)
- binding manganese (ii) ion: H369 (= H431), H376 (= H438), E413 (= E476)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
24% identity, 35% coverage: 192:518/934 of query aligns to 154:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R378), W322 (≠ F382), H369 (= H431), H376 (= H438), H414 (= H477)
- binding flavin-adenine dinucleotide: E200 (= E251), G201 (= G252), I206 (≠ V257), W322 (≠ F382), E413 (= E476), N450 (= N513)
- binding manganese (ii) ion: H369 (= H431), H376 (= H438), E413 (= E476)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
22% identity, 35% coverage: 192:518/934 of query aligns to 154:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: R317 (= R378), W321 (≠ F382), H368 (= H431), H375 (= H438), H413 (= H477)
- binding flavin-adenine dinucleotide: E200 (= E251), G201 (= G252), I206 (≠ V257), W321 (≠ F382), Y322 (≠ P383), E412 (= E476), H413 (= H477), N449 (= N513)
- binding manganese (ii) ion: H368 (= H431), H375 (= H438), E412 (= E476)
Sites not aligning to the query:
- binding 2-Ketohexanoic acid: 75
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
22% identity, 35% coverage: 192:518/934 of query aligns to 154:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: E200 (= E251), G201 (= G252), I206 (≠ V257), W322 (≠ F382), E413 (= E476), H414 (= H477), N450 (= N513)
- binding lactic acid: R318 (= R378), H369 (= H431), H376 (= H438), H414 (= H477)
- binding manganese (ii) ion: H369 (= H431), H376 (= H438), E413 (= E476)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
24% identity, 35% coverage: 192:518/934 of query aligns to 154:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R378), H369 (= H431), H376 (= H438), H414 (= H477)
- binding flavin-adenine dinucleotide: E200 (= E251), G201 (= G252), I206 (≠ V257), W322 (≠ F382), E413 (= E476), H414 (= H477), N450 (= N513)
- binding manganese (ii) ion: H369 (= H431), H376 (= H438), E413 (= E476)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
24% identity, 35% coverage: 192:518/934 of query aligns to 154:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R378), W322 (≠ F382), H369 (= H431), H376 (= H438), H413 (= H477)
- binding flavin-adenine dinucleotide: E200 (= E251), G201 (= G252), I206 (≠ V257), W322 (≠ F382), E412 (= E476), H413 (= H477), N449 (= N513)
- binding manganese (ii) ion: H369 (= H431), H376 (= H438), E412 (= E476)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
24% identity, 35% coverage: 192:518/934 of query aligns to 154:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R378), W322 (≠ F382), S336 (≠ I397), H369 (= H431), H376 (= H438), H413 (= H477)
- binding flavin-adenine dinucleotide: E200 (= E251), G201 (= G252), I206 (≠ V257), E412 (= E476), N449 (= N513)
- binding manganese (ii) ion: H369 (= H431), H376 (= H438), E412 (= E476)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
22% identity, 35% coverage: 192:518/934 of query aligns to 154:456/456 of 8jdrA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
22% identity, 35% coverage: 192:518/934 of query aligns to 154:456/456 of 8jdqA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
22% identity, 35% coverage: 192:518/934 of query aligns to 154:456/456 of 8jdoA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
22% identity, 35% coverage: 192:518/934 of query aligns to 154:456/456 of 8jdnA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
22% identity, 35% coverage: 192:518/934 of query aligns to 154:456/456 of 8jdgA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
22% identity, 35% coverage: 192:518/934 of query aligns to 154:456/456 of 8jdbA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
- binding (2R)-2-oxidanyloctanoic acid: 75
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
22% identity, 51% coverage: 38:514/934 of query aligns to 64:492/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
22% identity, 40% coverage: 137:514/934 of query aligns to 196:513/521 of Q8N465
- A205 (≠ S146) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (= A172) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G174) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (= D367) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R378) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ F382) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (= V395) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ I397) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ T415) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ G422) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H431) binding ; mutation to A: Loss of catalytic activity.
- G436 (≠ L433) to V: slight reduction in catalytic activity
- N439 (= N436) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H438) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ I440) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I441) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ I451) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E476) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H477) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G478) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 109 S → W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- 127 N → K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- 131 G → V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- 147 I → S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- 153 M → T: in D2HGA1; uncertain significance; significant loss of catalytic activity; M → V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 172 C → Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- 189 P → L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
24% identity, 54% coverage: 16:518/934 of query aligns to 14:465/465 of 3pm9A
- active site: A149 (= A149), L159 (≠ N159)
- binding flavin-adenine dinucleotide: P69 (≠ F70), Q70 (≠ R71), G71 (≠ A72), G72 (≠ A73), N73 (≠ G74), T74 (= T75), G75 (≠ S76), L76 (= L77), G79 (≠ Q80), Q80 (≠ A81), L91 (≠ I89), L133 (≠ P133), G134 (≠ A134), A135 (≠ T135), C139 (≠ A139), T140 (≠ M140), G142 (= G142), G143 (= G143), S146 (= S146), T147 (≠ N147), A149 (= A149), G150 (≠ S150), E200 (= E251), G201 (= G252), I205 (≠ F256), I206 (≠ V257), E423 (= E476)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
22% identity, 41% coverage: 132:514/934 of query aligns to 138:460/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R378), T337 (≠ F382), K348 (≠ I397), Y379 (= Y429), H381 (= H431), H388 (= H438), H423 (= H477)
- binding flavin-adenine dinucleotide: L139 (≠ P133), G140 (≠ A134), A141 (≠ T135), C145 (≠ A139), G149 (= G143), N150 (≠ I144), A152 (≠ S146), T153 (≠ N147), G157 (= G151), G207 (= G252), I212 (≠ V257), E422 (= E476), N459 (= N513)
- binding zinc ion: H381 (= H431), H388 (= H438), E422 (= E476)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 75, 76, 77, 78, 79, 80, 81, 82, 85, 86
Query Sequence
>7025755 FitnessBrowser__ANA3:7025755
MSINYDAVYKELIQQLGESAVSNDPVRRFAWSTDASYFRIVPEIVVHADTLEQAKQTLAI
ARAHKVPVTFRAAGTSLSGQAIGEGILLILGHDGFRTIDISPDSNKITLGAAVIGADANA
ALKPLNKKIGPDPATLASAMVGGIVSNNASGMCCGTAQNSYQTIASAKLLFADGTELNTG
CDKSKAAFTQSHGDLLDSLASLAKLTRSNEVLAQRIRKKYSIKNTTGYSINALVDFEDPF
DLINHLIVGAEGTLAFVEEVTYHTVDEAKFKASAMAVFFNMVDAASAIPPIIGDSVAAAE
LLDWASIKAVTGKKGMPDWLNELPEGAAILLIESRANDAQTLESYTQDVIAKLAHIKTER
PISFSSDANVYSKYWAMRSGLFPIIGGERPKGSSVIIEDVAFNVEHLAAAAADLTELFHK
HGYPEGVIYGHALAGNFHFIITPTFASQADIERFQGFMQDVAEMVIHKYDGSMKAEHGTG
RAVAPFVEMEWGADAYTLMKRIKHIFDPEGLLNPGVILNDDSTVHVKNIKPCPVVDDFVD
KCIECGFCEKTCPTSALNFSPRQRIATLREIERLEQSGDKAAAEKMRADAKYDVIDTCAA
CQLCTIACPVDNSMGQLVRKLRTPYISTTEQKVLDFQAKHFGAVNQVISTGFDVLGVIHK
ITGDGITNALMKTGRLLSKEVPYWNPDFPKGGKLPKPSPAKAGQETVVYFPACGGRTFGP
TPKDPDNRTLPEVVVTLLERAGYNVITPEKTRDLCCGQMWESKGDFKNADAKRQELIDVV
SKMSNGGKIPVLVDALSCTYRTLTGNPQVQITDLVEFMHDKLLDKLSINKKVNVALHLGC
SARKMKLEPKMQAIADACSSQVHKPAGIDCCGYAGEKGLYKPEINASALRNIKKLIPVEI
KEGYYANRMCEVGLTQHSGISYRHLAYLLEECSR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory