Comparing 7025756 FitnessBrowser__ANA3:7025756 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
5odqB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. (see paper)
23% identity, 96% coverage: 12:258/258 of query aligns to 1:268/291 of 5odqB
5odhH Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 3.5 minutes (see paper)
23% identity, 96% coverage: 12:258/258 of query aligns to 1:268/291 of 5odhH
5odhB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 3.5 minutes (see paper)
23% identity, 96% coverage: 12:258/258 of query aligns to 1:268/291 of 5odhB
5odcB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus at 2.3 a resolution (see paper)
23% identity, 96% coverage: 12:258/258 of query aligns to 1:268/291 of 5odcB
>7025756 FitnessBrowser__ANA3:7025756
MSFTNKKEKNTMKIALFIPCLVNQMMPDVAIATLELLEKLGHQVILPAGQTCCGQPMTNS
GCFDAARSTTLKLLNAFKGVECDAIVCPAASCLVAAKENFHEFDNSPEAQAVIDKLYELT
EFLHDVAPIPAFNKPFAHKISLQLSCHGIRMLSLATPSEQMGPRFNKVEAVLANIAGIDI
VYPDRRDECCGFGGTFAVDEGAVSAKMGKDKAQAHAATGAQYVVGFDPSCLLHLDGMIRR
QQLPIEIRHIAQVLNAAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory