SitesBLAST
Comparing 7025861 FitnessBrowser__ANA3:7025861 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
28% identity, 65% coverage: 24:270/380 of query aligns to 148:397/403 of 3ozwA
- binding flavin-adenine dinucleotide: R206 (= R79), Q207 (≠ S80), Y208 (= Y81), S209 (≠ T82), S222 (≠ T96), V223 (≠ I97), K224 (= K98), E226 (≠ V100), P232 (vs. gap), G234 (vs. gap), Y235 (≠ L104), V236 (= V105), S237 (= S106), V276 (≠ C145), T279 (= T148), V395 (≠ S268), F396 (= F269)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 50
- binding protoporphyrin ix containing fe: 42, 43, 81, 85, 88, 90, 94, 95, 98, 126, 130, 133
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: 53, 56, 102, 398
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
28% identity, 65% coverage: 24:270/380 of query aligns to 148:397/403 of 3ozvA
- binding flavin-adenine dinucleotide: R206 (= R79), Q207 (≠ S80), Y208 (= Y81), S209 (≠ T82), S222 (≠ T96), V223 (≠ I97), K224 (= K98), E226 (≠ V100), P232 (vs. gap), G234 (vs. gap), Y235 (≠ L104), V236 (= V105), S237 (= S106), V276 (≠ C145), T279 (= T148), F396 (= F269)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 24, 28, 57, 102, 106
- binding flavin-adenine dinucleotide: 44, 46, 48
- binding protoporphyrin ix containing fe: 43, 81, 84, 85, 88, 90, 94, 95, 98, 126, 130, 133
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
28% identity, 65% coverage: 24:270/380 of query aligns to 148:397/403 of 3ozuA
- binding flavin-adenine dinucleotide: R206 (= R79), Q207 (≠ S80), Y208 (= Y81), S209 (≠ T82), S222 (≠ T96), V223 (≠ I97), K224 (= K98), E226 (≠ V100), P232 (vs. gap), G234 (vs. gap), Y235 (≠ L104), V236 (= V105), S237 (= S106), E394 (= E267), V395 (≠ S268), G397 (≠ A270)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: 25, 28, 43, 56, 57, 102, 122, 125, 126
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
28% identity, 65% coverage: 24:270/380 of query aligns to 148:397/403 of P39662
Sites not aligning to the query:
- 60 A→Y: Does not affect phospholipid-binding.
- 98 V→F: Blocks phospholipid-binding.
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
28% identity, 65% coverage: 24:270/380 of query aligns to 148:397/403 of 1cqxA
- binding flavin-adenine dinucleotide: Y190 (≠ F65), R206 (= R79), Q207 (≠ S80), Y208 (= Y81), S209 (≠ T82), S222 (≠ T96), E226 (≠ V100), Q231 (vs. gap), P232 (vs. gap), G234 (vs. gap), Y235 (≠ L104), V236 (= V105), S237 (= S106), V395 (≠ S268), G397 (≠ A270)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
2eixA The structure of physarum polycephalum cytochrome b5 reductase (see paper)
28% identity, 57% coverage: 48:265/380 of query aligns to 29:241/243 of 2eixA
- active site: H47 (≠ F65), Y63 (= Y81), T64 (= T82), C217 (= C241)
- binding flavin-adenine dinucleotide: R61 (= R79), P62 (≠ S80), Y63 (= Y81), T64 (= T82), I78 (≠ T96), Y82 (≠ V100), K84 (≠ G102), G85 (= G103), M87 (≠ V105), S88 (= S106), T126 (≠ C145), T129 (= T148), F195 (≠ R220), M221 (≠ P245), A225 (= A249)
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
23% identity, 92% coverage: 26:374/380 of query aligns to 437:747/753 of 6laaA
- binding fe2/s2 (inorganic) cluster: S700 (≠ A327), C702 (= C329), E703 (≠ R330), G705 (= G332), C707 (= C334), G708 (= G335), C710 (= C337), C740 (= C367)
- binding flavin mononucleotide: R487 (= R79), Q488 (≠ S80), Y489 (= Y81), S490 (≠ T82), Q506 (≠ K98), S511 (≠ V100), R512 (≠ D101), G514 (= G103), S515 (= S106), I553 (≠ C145), E651 (≠ T262), F653 (≠ L264)
Sites not aligning to the query:
- active site: 177, 251, 252, 359, 360, 361
- binding carbonate ion: 90, 91, 92, 241
- binding protoporphyrin ix containing fe: 54, 91, 92, 99, 103, 249, 252, 253, 298, 351, 352, 353, 357, 359, 361
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
27% identity, 56% coverage: 59:270/380 of query aligns to 182:391/396 of 1gvhA
- binding flavin-adenine dinucleotide: Y188 (≠ F65), R204 (= R79), Q205 (≠ S80), Y206 (= Y81), S207 (≠ T82), A220 (≠ T96), V221 (≠ I97), E224 (≠ V100), G227 (= G103), Q228 (≠ L104), V229 (= V105), S230 (= S106), V269 (≠ C145), T272 (= T148), E388 (= E267), F390 (= F269)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 48, 50
- binding protoporphyrin ix containing fe: 43, 53, 56, 57, 60, 61, 81, 84, 85, 90, 94, 95, 127, 131, 393
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
27% identity, 56% coverage: 59:270/380 of query aligns to 182:391/396 of P24232
Sites not aligning to the query:
- 29 mutation Y->E,H: 15 to 35-fold reduction in NO dioxygenase activity.; Y→F: 30-fold reduction in NO dioxygenase activity, and 80-fold increase in the O(2) dissociation rate constant.
- 95 active site, Charge relay system
- 135 active site, Charge relay system
6kbhA Crystal structure of an intact type iv self-sufficient cytochrome p450 monooxygenase
24% identity, 88% coverage: 45:379/380 of query aligns to 470:765/765 of 6kbhA
- binding fe2/s2 (inorganic) cluster: C714 (= C329), E715 (≠ R330), G717 (= G332), C719 (= C334), G720 (= G335), C722 (= C337), C752 (≠ A366)
- binding flavin mononucleotide: R499 (= R79), Q500 (≠ S80), Y501 (= Y81), S502 (≠ T82), A516 (≠ T96), L518 (vs. gap), S523 (≠ V100), R524 (≠ D101), G526 (= G103), S527 (= S106), I565 (≠ C145), T568 (= T148), E663 (= E267), F665 (= F269), I718 (≠ V333)
Sites not aligning to the query:
- active site: 190, 264, 265, 372, 373, 374
- binding protoporphyrin ix containing fe: 67, 104, 105, 112, 116, 261, 262, 265, 266, 308, 311, 313, 364, 365, 370, 372, 373, 374, 378
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
25% identity, 55% coverage: 60:269/380 of query aligns to 44:244/250 of 1tvcA
- active site: Y63 (= Y81), S64 (≠ T82), L215 (= L240)
- binding dihydroflavine-adenine dinucleotide: F49 (= F65), R61 (= R79), S62 (= S80), Y63 (= Y81), S64 (≠ T82), L78 (≠ T96), I79 (= I97), R80 (≠ K98), L82 (≠ V100), F87 (≠ V105), G128 (= G146), N155 (≠ R173), E159 (≠ D177), S186 (≠ E212), G187 (≠ A213), E242 (= E267), F244 (= F269)
Sites not aligning to the query:
P17571 Nitrate reductase [NADH] 1; NR; EC 1.7.1.1 from Zea mays (Maize) (see 3 papers)
26% identity, 69% coverage: 2:265/380 of query aligns to 333:618/621 of P17571
- RAYT 413:416 (≠ RSYT 79:82) binding
- LVK 430:432 (≠ MLT 94:96) binding
- F435 (vs. gap) binding
- LMT 447:449 (≠ LVS 104:106) binding
- S497 (≠ C145) binding
- T500 (= T148) binding
- C593 (= C241) Necessary for efficient electron Transfer; mutation to S: Reduction of activity.
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
24% identity, 58% coverage: 54:272/380 of query aligns to 123:332/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (≠ F65), R144 (= R79), Q145 (≠ S80), Y146 (= Y81), S147 (≠ T82), H161 (≠ T96), V162 (≠ I97), V165 (= V100), G168 (= G103), V169 (≠ L104), A170 (≠ V105), T171 (≠ S106), T214 (≠ C145), F329 (= F269), P331 (≠ T271)
Sites not aligning to the query:
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
24% identity, 58% coverage: 54:272/380 of query aligns to 124:333/334 of P0DPQ8
Sites not aligning to the query:
- 35 binding
- 40 binding
- 43 binding
- 75 binding
- 334 binding
1cnfA Structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain (see paper)
27% identity, 58% coverage: 42:263/380 of query aligns to 14:255/260 of 1cnfA
- active site: H38 (≠ F65), Y54 (= Y81), T55 (= T82), C232 (= C241)
- binding adenosine-5'-diphosphate: K71 (≠ T96), N165 (≠ A172), P234 (= P243), P236 (= P245), M237 (≠ Y246), F240 (vs. gap), A241 (= A249)
- binding flavin-adenine dinucleotide: R52 (= R79), A53 (≠ S80), Y54 (= Y81), L69 (≠ M94), Y73 (vs. gap), F81 (≠ R99), G84 (= G102), G85 (= G103), L86 (= L104), M87 (≠ V105), T88 (≠ S106), S136 (≠ C145), T139 (= T148), P140 (= P149)
1cneA Structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain (see paper)
26% identity, 58% coverage: 42:263/380 of query aligns to 14:255/260 of 1cneA
- active site: H38 (≠ F65), Y54 (= Y81), T55 (= T82), S232 (vs. gap)
- binding flavin-adenine dinucleotide: R52 (= R79), A53 (≠ S80), Y54 (= Y81), L69 (≠ M94), V70 (≠ L95), Y73 (vs. gap), H78 (vs. gap), G84 (= G102), M87 (≠ V105), T88 (≠ S106)
Sites not aligning to the query:
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
24% identity, 63% coverage: 33:270/380 of query aligns to 112:335/337 of 1krhA
- active site: C306 (= C241)
- binding flavin-adenine dinucleotide: Y143 (≠ F65), R155 (= R79), S156 (= S80), Y157 (= Y81), S158 (≠ T82), V171 (≠ T96), V172 (≠ I97), G178 (= G103), K179 (≠ L104), M180 (≠ V105), S181 (= S106), T219 (≠ C145), E332 (= E267), F334 (= F269), S335 (≠ A270)
Sites not aligning to the query:
Q9L6V3 Flavodoxin/ferredoxin--NADP reductase; Ferredoxin (flavodoxin):NADP(+) oxidoreductase; Ferredoxin--NADP reductase; FNR; Flavodoxin--NADP reductase; FLDR; EC 1.18.1.2; EC 1.19.1.1 from Rhodobacter capsulatus (Rhodopseudomonas capsulata) (see 3 papers)
27% identity, 54% coverage: 23:226/380 of query aligns to 8:206/270 of Q9L6V3
Sites not aligning to the query:
- 238 binding
- 264 A→Y: 3-fold decrease in kcat.
- 264:270 binding
3crzA Ferredoxin-NADP reductase (see paper)
26% identity, 43% coverage: 32:194/380 of query aligns to 7:165/257 of 3crzA
- binding flavin-adenine dinucleotide: F36 (= F65), R50 (= R79), A51 (≠ S80), Y52 (= Y81), S53 (≠ T82), F66 (≠ L95), S67 (≠ T96), I68 (= I97), G73 (= G102), P74 (≠ G103), L75 (= L104), T76 (≠ V105), T116 (≠ C145)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T114 (≠ A143), G142 (≠ S171), V143 (≠ A172), R144 (= R173)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 251, 252, 253, 254, 256, 257
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 180, 181, 189, 191, 220, 221, 222, 223, 226, 254, 256
1a8pA Ferredoxin reductase from azotobacter vinelandii (see paper)
25% identity, 52% coverage: 26:221/380 of query aligns to 1:190/257 of 1a8pA
- binding flavin-adenine dinucleotide: F36 (= F65), R50 (= R79), A51 (≠ S80), Y52 (= Y81), S53 (≠ T82), I68 (= I97), V70 (≠ R99), G73 (= G102), P74 (≠ G103), L75 (= L104), T76 (≠ V105), T116 (≠ C145)
Sites not aligning to the query:
Query Sequence
>7025861 FitnessBrowser__ANA3:7025861
MDTKTMNISTMQNIMPSPALSSAPASVVGFSQLVCVERWNETADVVSFRFQAGEPMKFDY
KPGQFMTLVLEINGEQACRSYTLSSTPSRPYSLMLTIKRVDGGLVSNYLIDHLQPGQTVR
VLPPTGQFNLFDIPAKKYLFLSAGCGITPMYSMSRYLTDSQMNADIAFVHSARTQADIIF
KTSLETMATRHRDFKLRYIVEDVTADTAWHPEAVLHNVGRLRPDNLRDLVPDFAERTVFL
CGPEPYMQAVKTILAELNFDMTQLYHESFATAVKEAQSRVKQAEMQTEAPESGSNSFMLS
IGDKKRALTAEQTLLEGIEAEGLPIIAACRSGVCGACKCQVLEGETESTSSMTLTPSEIE
AGYVLACSTKLKSDVTLSLT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory