Comparing 7025893 FitnessBrowser__ANA3:7025893 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P23533 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Staphylococcus carnosus (strain TM300) (see paper)
34% identity, 76% coverage: 170:733/744 of query aligns to 5:569/573 of P23533
2wqdA Crystal structure of enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system in the dephosphorylated state (see paper)
33% identity, 76% coverage: 169:734/744 of query aligns to 3:570/570 of 2wqdA
P08839 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 77% coverage: 169:739/744 of query aligns to 1:574/575 of P08839
2hwgA Structure of phosphorylated enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system (see paper)
33% identity, 76% coverage: 172:737/744 of query aligns to 3:571/572 of 2hwgA
2xz7A Crystal structure of the phosphoenolpyruvate-binding domain of enzyme i in complex with phosphoenolpyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
40% identity, 42% coverage: 424:734/744 of query aligns to 11:321/324 of 2xz7A
2xz9A Crystal structure from the phosphoenolpyruvate-binding domain of enzyme i in complex with pyruvate from the thermoanaerobacter tengcongensis pep-sugar phosphotransferase system (pts) (see paper)
40% identity, 42% coverage: 424:734/744 of query aligns to 4:314/317 of 2xz9A
5lu4A C4-type pyruvate phosphate dikinase: conformational intermediate of central domain in the swiveling mechanism (see paper)
26% identity, 47% coverage: 342:689/744 of query aligns to 444:834/850 of 5lu4A
Sites not aligning to the query:
O23404 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 50% coverage: 319:689/744 of query aligns to 512:944/963 of O23404
5jvjB C4-type pyruvate phosphate dikinase: different conformational states of the nucleotide binding domain in the dimer (see paper)
25% identity, 47% coverage: 342:689/744 of query aligns to 371:779/797 of 5jvjB
Sites not aligning to the query:
Q39735 Pyruvate, phosphate dikinase, chloroplastic; Cold-sensitive pyruvate, orthophosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Flaveria bidentis (Coastal plain yellowtops) (Ethulia bidentis) (see 2 papers)
25% identity, 47% coverage: 342:689/744 of query aligns to 523:935/953 of Q39735
Sites not aligning to the query:
5jvlA C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
25% identity, 47% coverage: 342:689/744 of query aligns to 444:856/874 of 5jvlA
Sites not aligning to the query:
1vbgA Pyruvate phosphate dikinase from maize (see paper)
24% identity, 47% coverage: 343:689/744 of query aligns to 445:856/874 of 1vbgA
Sites not aligning to the query:
P11155 Pyruvate, phosphate dikinase 1, chloroplastic; Pyruvate, orthophosphate dikinase 1; EC 2.7.9.1 from Zea mays (Maize) (see 7 papers)
24% identity, 47% coverage: 343:691/744 of query aligns to 518:931/947 of P11155
Sites not aligning to the query:
1kc7A Pyruvate phosphate dikinase with bound mg-phosphonopyruvate (see paper)
25% identity, 47% coverage: 343:689/744 of query aligns to 443:852/872 of 1kc7A
Sites not aligning to the query:
P22983 Pyruvate, phosphate dikinase; Pyruvate, orthophosphate dikinase; EC 2.7.9.1 from Clostridium symbiosum (Bacteroides symbiosus) (see 4 papers)
24% identity, 47% coverage: 343:689/744 of query aligns to 444:853/874 of P22983
Sites not aligning to the query:
1vbhA Pyruvate phosphate dikinase with bound mg-pep from maize (see paper)
23% identity, 47% coverage: 343:689/744 of query aligns to 436:844/862 of 1vbhA
Sites not aligning to the query:
5jvlB C4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue (see paper)
25% identity, 46% coverage: 351:689/744 of query aligns to 122:502/520 of 5jvlB
Sites not aligning to the query:
Q02KR1 Phosphoenolpyruvate synthase; PEP synthase; Pyruvate, water dikinase; EC 2.7.9.2 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
25% identity, 59% coverage: 267:702/744 of query aligns to 333:784/791 of Q02KR1
5hv1A Rifampin phosphotransferase in complex with amppnp and rifampin from listeria monocytogenes (see paper)
33% identity, 12% coverage: 305:394/744 of query aligns to 760:845/847 of 5hv1A
Sites not aligning to the query:
5fbsA Crystal structure of rifampin phosphotransferase rph-lm from listeria monocytogenes in complex with adp and magnesium (see paper)
33% identity, 12% coverage: 305:394/744 of query aligns to 702:787/787 of 5fbsA
Sites not aligning to the query:
>7025893 FitnessBrowser__ANA3:7025893
MLNTLRDITQAVASAHSLETALEVLVSSTKAAMETQCCSVYILDQQELVLSATDGLEKSA
VGRVRMPLTQGLVGLAAEREEAVNLADARLHPRFKLFPEVAEEEYRAFLAVPIIYQKAVV
GVIVVQQASARQFSEGEEAFLMTLAAQLAMAIRGLKQKAQVSSLHQQILFQGTSASSGIA
IAHALVLGGEISLEQPDVRCEDIVLESSRLVAAMGRCKEAIGALSQRFDREQDEEVASIF
NALQLLLDDVSLGGEYAREVQQGWEAESAVSRVSLRYIQQFLAMEDPYLKERASDIRDLG
QKVLRQLIEPERLELEPDKPVILVTREADATMLAEFPRQKLAGIVTELGGVNSHAAILAR
ALGVPAITGVEQLLSADIDQKLLVVNASRGQLMVSPSPAIVSEYRSLISAQKALQRQYAQ
ELALPSVMLDGTRIRLYLNAGLLSGVASEIAEGADGIGLYRTEIPFMLQQRFPSESEQVK
VYQQVLSAASGRPVVMRTLDVGGDKPLPYFPIKEDNPFLGWRGIRLSLDHPELFLVQLRA
MLQAGGECKQLSILLPMVSNLDEIDQSLAYLEQAYVELKNDVNSQIEMPRIGIMLEVPAL
LYQLDEVAKRVDFVSVGSNDLTQYLLAVDRNNPRVSSLFDSYHPGILRALHQARLDCDYH
ELDISICGELAGEPMGAILLVAMGYQHLSMNQGSLARINYLLRRVSRADLTQLLSQALSL
SNGFQVRELVKEYLTQQGLATILN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory