Comparing 7025951 Shewana3_3099 peptidase C26 (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
7d53A Spua mutant - h221n with glu (see paper)
64% identity, 98% coverage: 4:251/253 of query aligns to 2:249/249 of 7d53A
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
64% identity, 98% coverage: 4:251/253 of query aligns to 8:255/255 of 7d50B
7d4rB Spua native structure (see paper)
56% identity, 96% coverage: 5:248/253 of query aligns to 1:214/215 of 7d4rB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
45% identity, 98% coverage: 6:253/253 of query aligns to 8:253/254 of P76038
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
45% identity, 98% coverage: 6:253/253 of query aligns to 6:251/252 of 6vtvB
3fijA Crystal structure of a uncharacterized protein lin1909
33% identity, 88% coverage: 24:246/253 of query aligns to 7:222/224 of 3fijA
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 96% coverage: 1:244/253 of query aligns to 61:295/308 of O33341
1vcnA Crystal structure of t.Th. Hb8 ctp synthetase complex with sulfate anion (see paper)
30% identity, 50% coverage: 100:226/253 of query aligns to 347:485/506 of 1vcnA
Sites not aligning to the query:
>7025951 Shewana3_3099 peptidase C26 (RefSeq)
MSVELPLIGVIACNQQLGSHPFNIVGEKYLLGVVNGAKGWPLVIPSLGAEQPIEAILASL
DGILFTGSPSNVEPHLYAGEPSEVGTHHDPKRDATTLPLIRAAIAAGVPVLGICRGFQEM
NVAFGGSLHQKLHEVGGFIEHREDKEASLEVQYGPSHSITVEPGGVIYEAWGRNSAEVNS
VHTQGVERLGIGLRPEAYAPDGLVEAFSVIDTNEFALGVQWHPEWKVSENPFFLSIFNAF
GDACRRRATTRVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory