SitesBLAST
Comparing 7026015 FitnessBrowser__ANA3:7026015 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
40% identity, 94% coverage: 10:400/417 of query aligns to 11:420/425 of O59010
- S65 (≠ A58) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S261) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 261:263) binding
- M311 (= M296) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ C299) binding
- V355 (= V341) binding
- D394 (= D374) binding
- M395 (= M375) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R377) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N381) binding
- D405 (= D385) mutation to N: Strongly decreased affinity for aspartate.
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
39% identity, 97% coverage: 2:407/417 of query aligns to 1:427/427 of 5e9sA
- binding aspartic acid: R274 (≠ S261), S275 (= S262), S276 (= S263), T313 (≠ C299), G353 (= G340), V354 (= V341), A357 (≠ S344), G358 (≠ A345), D394 (= D374), R397 (= R377), T398 (= T378)
- binding decyl-beta-d-maltopyranoside: L194 (≠ Q180), G198 (≠ M184), Y202 (≠ L188)
- binding sodium ion: Y87 (≠ F83), T90 (= T86), S91 (≠ G87), S276 (= S263), G305 (= G291), A306 (= A292), T307 (= T293), N309 (= N295), N309 (= N295), M310 (= M296), D311 (= D297), S348 (= S335), I349 (≠ V336), G350 (= G337), T351 (= T338), N401 (= N381), V402 (= V382), D405 (= D385)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
39% identity, 95% coverage: 10:407/417 of query aligns to 6:424/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ Q180), G195 (≠ M184), R282 (= R272)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S261), S272 (= S262), S273 (= S263), M307 (= M296), T310 (≠ C299), G353 (= G343), A354 (≠ S344), R394 (= R377), T395 (= T378)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
39% identity, 95% coverage: 10:407/417 of query aligns to 7:425/425 of 6zgbA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
39% identity, 97% coverage: 2:406/417 of query aligns to 1:426/426 of 6xwnB
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
39% identity, 95% coverage: 10:407/417 of query aligns to 2:416/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S261), S265 (= S263), M299 (= M296), T302 (≠ C299), T340 (= T338), G342 (= G340), V343 (= V341), G347 (≠ A345), D383 (= D374), R386 (= R377), T387 (= T378), N390 (= N381)
- binding decyl-beta-d-maltopyranoside: H23 (≠ E31), V212 (≠ L209), A216 (≠ G213)
2nwwA Crystal structure of gltph in complex with tboa (see paper)
39% identity, 93% coverage: 10:396/417 of query aligns to 2:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
39% identity, 94% coverage: 10:399/417 of query aligns to 11:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L39), F46 (≠ L39), P75 (≠ Q69), L91 (= L85), F95 (≠ V89), L130 (≠ F122), I133 (≠ V125), I159 (≠ A151), Y167 (vs. gap), K196 (≠ Q180), G200 (≠ M184), I207 (= I191), F210 (= F194), L250 (= L234), I262 (≠ F247), M269 (≠ Q254), T334 (≠ D320), V335 (≠ T321), G336 (≠ L322), T340 (≠ M326), L343 (≠ V329), M399 (≠ A379)
- binding aspartic acid: S277 (= S262), S278 (= S263), T314 (≠ C299), G354 (= G340), A358 (≠ S344), G359 (≠ A345), D394 (= D374), R397 (= R377), T398 (= T378)
- binding sodium ion: Y89 (≠ F83), T92 (= T86), S93 (≠ G87), G306 (= G291), T308 (= T293), N310 (= N295), N310 (= N295), M311 (= M296), D312 (= D297), S349 (= S335), I350 (≠ V336), T352 (= T338), N401 (= N381), V402 (= V382), D405 (= D385)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
39% identity, 93% coverage: 10:396/417 of query aligns to 8:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (≠ S62), V83 (≠ L80), I157 (≠ L152), Y164 (vs. gap), K193 (≠ Q180), T305 (= T293), I306 (≠ M294), I347 (≠ V336)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ V15), M199 (≠ L186), S275 (= S263), T311 (≠ C299), G356 (≠ A345), L384 (≠ A367), D391 (= D374), R394 (= R377)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
39% identity, 93% coverage: 10:396/417 of query aligns to 3:408/408 of 6bauA
- binding cysteine: S270 (= S263), M303 (= M296), T306 (≠ C299), A345 (= A339), G346 (= G340), V347 (= V341), G351 (≠ A345), D386 (= D374), C389 (≠ R377), T390 (= T378), N393 (= N381)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
39% identity, 93% coverage: 10:396/417 of query aligns to 3:408/409 of 6bavA
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
37% identity, 93% coverage: 10:396/417 of query aligns to 3:396/396 of 6bmiA
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
29% identity, 96% coverage: 16:417/417 of query aligns to 26:482/503 of Q10901
- N177 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (≠ D140) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
30% identity, 92% coverage: 18:400/417 of query aligns to 18:419/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S262), S281 (= S263), T318 (≠ C299), G363 (≠ A345), M367 (≠ L349), V385 (≠ A367), D388 (= D370), R395 (= R377), T396 (= T378)
- binding dodecyl beta-D-glucopyranoside: V19 (≠ F19), I20 (= I20), W389 (≠ R371)
- binding cholesterol hemisuccinate: R80 (= R74), R84 (≠ K78), I95 (≠ V89), I252 (≠ L234)
Sites not aligning to the query:
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
30% identity, 87% coverage: 40:403/417 of query aligns to 57:410/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ N71), G89 (≠ K73), G92 (≠ S76), A95 (≠ T79), V96 (≠ L80), Y99 (≠ F83), M163 (≠ A151), F167 (≠ I155), F293 (= F286), V297 (≠ L290)
- binding aspartic acid: S268 (= S262), S269 (= S263), T306 (≠ C299), G346 (= G340), I347 (≠ V341), A350 (≠ S344), G351 (≠ A345), D380 (= D374), R383 (= R377), T384 (= T378)
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
30% identity, 92% coverage: 18:400/417 of query aligns to 17:420/425 of 7xr4A
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
31% identity, 91% coverage: 18:398/417 of query aligns to 10:402/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ A58), L58 (≠ I59), L65 (= L66), V339 (= V336), G340 (= G337), S343 (≠ G340), I344 (≠ V341)
- binding cholesterol: W188 (≠ K187), I227 (≠ L224), F250 (= F247), W257 (≠ Q254), M379 (≠ I376), S382 (≠ A379)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S263), M300 (= M296), T303 (≠ C299), Y306 (= Y303), G348 (≠ A345), L349 (≠ M346), M352 (≠ L349), I366 (= I363), L369 (≠ I366), V370 (≠ A367), D373 (= D370), D377 (= D374), R380 (= R377), T381 (= T378), N384 (= N381)
Sites not aligning to the query:
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
35% identity, 67% coverage: 137:417/417 of query aligns to 234:524/573 of P31596
- K298 (≠ W199) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (= H226) mutation H->N,T,K,R: No transporter activity.
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
35% identity, 67% coverage: 137:417/417 of query aligns to 234:524/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
29% identity, 87% coverage: 40:403/417 of query aligns to 49:396/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I63), S80 (≠ N71), G81 (≠ K73), G84 (≠ S76), Y91 (≠ F83), M156 (≠ A151), F160 (≠ I155), F286 (= F286), V290 (≠ L290)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V55), I148 (≠ V143), S262 (= S263), S263 (≠ F264), A292 (= A292), T293 (= T293), M296 (= M296), T299 (≠ C299), G329 (= G337), A336 (≠ S344), G337 (≠ A345), D366 (= D374), R369 (= R377), N373 (= N381)
Query Sequence
>7026015 FitnessBrowser__ANA3:7026015
MILQTISRIPFWQKVLAGFILGALVGVLLGETATVLKPLGDLFISAIKMLVAPLVFCAIV
VSITSLGSQTNLKRLSLKTLGMFMLTGTVASLIGLAVGSLIDMGGTMQLATTEVRERNIP
GFAQVLLDMIPVNPFASLADGKVLQIIVFAALVGIAINKVGEKAEPLKRTIEAGAEVMFQ
LTRMVLKLTPIGVFGLMAWVVGEYGLSTLLPLGKFIAAIYIAALIHMIFVYGGLVKFAAG
LSPVQFFRKAMPAQLVAFSTSSSFGTLPASTRAVETMGVSKRYSAFVMPLGATMNMDGCG
GIYPAIAAIFIAQIYGIPLDTLDYVMIAVTATVASVGTAGVPGSAMVMLTVTLGVIGLPL
EGIAFIAAIDRIIDMIRTATNVTGDMMTAVVIGKSENELDVEQFYSNETQTAAIADN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory