SitesBLAST
Comparing 7026032 FitnessBrowser__ANA3:7026032 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
53% identity, 100% coverage: 1:397/397 of query aligns to 1:396/396 of 1gvhA
- binding flavin-adenine dinucleotide: S46 (≠ A46), Q48 (= Q48), N50 (≠ S50), Y188 (= Y190), R204 (= R206), Q205 (= Q207), Y206 (= Y208), S207 (= S209), A220 (≠ T222), V221 (= V223), E224 (= E226), G227 (= G229), Q228 (= Q230), V229 (= V231), S230 (= S232), V269 (= V271), T272 (= T274), E388 (= E389), F390 (= F391)
- binding protoporphyrin ix containing fe: F43 (= F43), Q53 (= Q53), A56 (= A56), L57 (= L57), A60 (= A60), I61 (≠ V61), I81 (= I81), K84 (= K84), H85 (= H85), I90 (= I90), Q94 (= Q94), Y95 (= Y95), L127 (= L129), F131 (= F133), H393 (= H394)
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
53% identity, 100% coverage: 1:397/397 of query aligns to 1:396/396 of P24232
- Y29 (= Y29) mutation Y->E,H: 15 to 35-fold reduction in NO dioxygenase activity.; mutation to F: 30-fold reduction in NO dioxygenase activity, and 80-fold increase in the O(2) dissociation rate constant.
- Y95 (= Y95) active site, Charge relay system
- E135 (= E137) active site, Charge relay system
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
45% identity, 99% coverage: 1:393/397 of query aligns to 1:398/403 of 3ozwA
- binding flavin-adenine dinucleotide: A46 (= A46), Q50 (≠ S50), R206 (= R206), Q207 (= Q207), Y208 (= Y208), S209 (= S209), S222 (≠ T222), V223 (= V223), K224 (= K224), E226 (= E226), P232 (vs. gap), G234 (vs. gap), Y235 (vs. gap), V236 (= V231), S237 (= S232), V276 (= V271), T279 (= T274), V395 (= V390), F396 (= F391)
- binding protoporphyrin ix containing fe: V42 (= V42), F43 (= F43), I81 (= I81), H85 (= H85), L88 (≠ F88), V90 (≠ I90), Q94 (= Q94), Y95 (= Y95), V98 (= V98), Y126 (= Y126), A130 (= A130), L133 (≠ F133)
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: Q53 (= Q53), A56 (= A56), L102 (= L102), P398 (= P393)
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
45% identity, 99% coverage: 1:393/397 of query aligns to 1:398/403 of 3ozvA
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: I24 (≠ L24), F28 (= F28), L57 (= L57), L102 (= L102), I106 (≠ L106)
- binding flavin-adenine dinucleotide: N44 (= N44), A46 (= A46), Q48 (= Q48), R206 (= R206), Q207 (= Q207), Y208 (= Y208), S209 (= S209), S222 (≠ T222), V223 (= V223), K224 (= K224), E226 (= E226), P232 (vs. gap), G234 (vs. gap), Y235 (vs. gap), V236 (= V231), S237 (= S232), V276 (= V271), T279 (= T274), F396 (= F391)
- binding protoporphyrin ix containing fe: F43 (= F43), I81 (= I81), K84 (= K84), H85 (= H85), L88 (≠ F88), V90 (≠ I90), Q94 (= Q94), Y95 (= Y95), V98 (= V98), Y126 (= Y126), A130 (= A130), L133 (≠ F133)
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
45% identity, 99% coverage: 1:393/397 of query aligns to 1:398/403 of 3ozuA
- binding flavin-adenine dinucleotide: A46 (= A46), H47 (= H47), R206 (= R206), Q207 (= Q207), Y208 (= Y208), S209 (= S209), S222 (≠ T222), V223 (= V223), K224 (= K224), E226 (= E226), P232 (vs. gap), G234 (vs. gap), Y235 (vs. gap), V236 (= V231), S237 (= S232), E394 (= E389), V395 (= V390), G397 (= G392), P398 (= P393)
- binding protoporphyrin ix containing fe: F43 (= F43), N44 (= N44), I81 (= I81), H85 (= H85), L88 (≠ F88), V90 (≠ I90), Q94 (= Q94), Y95 (= Y95), V98 (= V98), Y126 (= Y126), L129 (= L129), A130 (= A130), L133 (≠ F133)
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: I25 (≠ T25), F28 (= F28), F43 (= F43), A56 (= A56), L57 (= L57), L102 (= L102), W122 (= W122), A125 (= A125), Y126 (= Y126)
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
45% identity, 99% coverage: 1:393/397 of query aligns to 1:398/403 of P39662
- A60 (= A60) mutation to Y: Does not affect phospholipid-binding.
- V98 (= V98) mutation to F: Blocks phospholipid-binding.
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
45% identity, 99% coverage: 1:393/397 of query aligns to 1:398/403 of 1cqxA
- binding flavin-adenine dinucleotide: A46 (= A46), H47 (= H47), Y190 (= Y190), R206 (= R206), Q207 (= Q207), Y208 (= Y208), S209 (= S209), S222 (≠ T222), E226 (= E226), Q231 (vs. gap), P232 (vs. gap), G234 (vs. gap), Y235 (vs. gap), V236 (= V231), S237 (= S232), V395 (= V390), G397 (= G392), P398 (= P393)
- binding protoporphyrin ix containing fe: F43 (= F43), N44 (= N44), I81 (= I81), H85 (= H85), L88 (≠ F88), V90 (≠ I90), Q94 (= Q94), Y95 (= Y95), V98 (= V98), Y126 (= Y126), L129 (= L129), A130 (= A130), L133 (≠ F133)
4g1bA X-ray structure of yeast flavohemoglobin in complex with econazole (see paper)
35% identity, 99% coverage: 1:393/397 of query aligns to 1:392/398 of 4g1bA
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: F28 (= F28), Y29 (= Y29), A56 (= A56), L57 (= L57), T60 (≠ A60), L102 (= L102), Y126 (= Y126)
- binding flavin-adenine dinucleotide: T46 (≠ A46), V50 (≠ S50), K84 (= K84), Y189 (= Y190), R207 (= R206), H208 (≠ Q207), Y209 (= Y208), S210 (= S209), A223 (≠ T222), K225 (= K224), E227 (= E226), F233 (vs. gap), P234 (vs. gap), G236 (= G229), L237 (≠ Q230), V238 (= V231), S239 (= S232), V282 (= V271), F390 (= F391)
- binding protoporphyrin ix containing fe: I42 (≠ V42), F43 (= F43), N44 (= N44), N47 (≠ H47), T60 (≠ A60), Q80 (≠ R80), I81 (= I81), K84 (= K84), H85 (= H85), L88 (≠ F88), I90 (= I90), H94 (≠ Q94), Y95 (= Y95), V98 (= V98), F133 (= F133), P392 (= P393)
Sites not aligning to the query:
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
45% identity, 60% coverage: 155:393/397 of query aligns to 4:237/237 of 4eh1A
- binding flavin-adenine dinucleotide: Y39 (= Y190), R55 (= R206), Q56 (= Q207), Y57 (= Y208), S58 (= S209), S71 (≠ T222), V72 (= V223), E75 (= E226), N81 (vs. gap), G83 (vs. gap), L84 (vs. gap), V85 (= V231), S86 (= S232), T127 (= T274), E233 (= E389), F235 (= F391)
Q03331 Flavohemoprotein; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Candida norvegensis (Yeast) (Candida mycoderma) (see paper)
32% identity, 72% coverage: 2:285/397 of query aligns to 13:292/390 of Q03331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
6o0aA Crystal structure of flavohemoglobin from malassezia yamatoensis with bound fad and heme determined by iron sad phasing (see paper)
27% identity, 98% coverage: 2:392/397 of query aligns to 3:383/383 of 6o0aA
- binding flavin-adenine dinucleotide: S48 (≠ A46), R51 (≠ H49), D52 (≠ S50), Y190 (= Y190), R205 (= R206), Q206 (= Q207), F207 (≠ Y208), T208 (≠ S209), K222 (= K224), D224 (≠ E226), H226 (≠ N228), G227 (= G229), E228 (≠ Q230), M229 (≠ V231), T230 (≠ S232), T274 (= T274), E380 (= E389), F382 (= F391), G383 (= G392)
- binding protoporphyrin ix containing fe: M44 (≠ V42), F45 (= F43), S46 (≠ N44), L59 (= L57), S62 (≠ A60), R84 (= R80), V85 (≠ I81), H89 (= H85), L92 (≠ F88), L94 (≠ I90), E98 (≠ Q94), Y99 (= Y95), V102 (= V98), Y130 (= Y126), L133 (= L129)
3tm9A Y29a mutant of vitreoscilla stercoraria hemoglobin (see paper)
41% identity, 37% coverage: 1:146/397 of query aligns to 1:146/146 of 3tm9A
- binding protoporphyrin ix containing fe: L42 (≠ V42), F43 (= F43), Q53 (= Q53), L57 (= L57), T60 (≠ A60), I81 (= I81), K84 (= K84), H85 (= H85), V90 (≠ I90), Y95 (= Y95), V98 (= V98), Y126 (= Y126), F133 (= F133)
4vhbA Thiocyanate adduct of the bacterial hemoglobin from vitreoscilla sp. (see paper)
40% identity, 37% coverage: 1:146/397 of query aligns to 1:138/138 of 4vhbA
- binding protoporphyrin ix containing fe: L42 (≠ V42), F43 (= F43), L49 (= L57), T52 (≠ A60), I73 (= I81), K76 (= K84), H77 (= H85), V82 (≠ I90), H86 (≠ Q94), Y87 (= Y95), V90 (= V98), F125 (= F133)
- binding thiocyanate ion: F28 (= F28), L49 (= L57)
3vhbA Imidazole adduct of the bacterial hemoglobin from vitreoscilla sp. (see paper)
41% identity, 36% coverage: 2:144/397 of query aligns to 1:134/135 of 3vhbA
- binding protoporphyrin ix containing fe: F42 (= F43), L47 (= L57), T50 (≠ A60), I71 (= I81), K74 (= K84), H75 (= H85), V80 (≠ I90), H84 (≠ Q94), Y85 (= Y95), V88 (= V98), Y116 (= Y126), F123 (= F133)
- binding imidazole: Y28 (= Y29), L47 (= L57)
7dihA Crystal structure of thermoglobin y29f mutant in complex with imidazole
41% identity, 36% coverage: 1:143/397 of query aligns to 1:138/139 of 7dihA
- binding protoporphyrin ix containing fe: L42 (≠ V42), F43 (= F43), A46 (= A46), S47 (= S50), Q50 (= Q53), L54 (= L57), I78 (= I81), S81 (≠ K84), H82 (= H85), V87 (≠ I90), H91 (≠ Q94), Y92 (= Y95), V95 (= V98), Y121 (= Y126), L124 (= L129)
2wy4A Structure of bacterial globin from campylobacter jejuni at 1.35 a resolution (see paper)
41% identity, 35% coverage: 7:143/397 of query aligns to 5:139/139 of 2wy4A
- binding protoporphyrin ix containing fe: M40 (≠ V42), F41 (= F43), N42 (= N44), Q51 (= Q53), L55 (= L57), A58 (= A60), V79 (≠ I81), T82 (≠ K84), H83 (= H85), L86 (≠ F88), V88 (≠ I90), H92 (≠ Q94), Y93 (= Y95), V96 (= V98), Y129 (≠ F133)
6wk3D Engineered carbene transferase rmanod q52v, putative nitric oxide dioxygenase from rhodothermus marinus (see paper)
32% identity, 35% coverage: 2:141/397 of query aligns to 6:141/146 of 6wk3D
- binding copper (ii) ion: E51 (≠ H47), H55 (= H49)
- binding protoporphyrin ix containing fe: L46 (≠ V42), F47 (= F43), L57 (= L57), R80 (= R80), M81 (≠ I81), S84 (≠ K84), H85 (= H85), R87 (≠ G87), A88 (≠ F88), V90 (≠ I90), H94 (≠ Q94), Y95 (= Y95), V98 (= V98), Y126 (= Y126)
2piaA Phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s] (see paper)
28% identity, 60% coverage: 153:392/397 of query aligns to 7:226/321 of 2piaA
- binding flavin mononucleotide: N44 (≠ Y190), R55 (= R206), T56 (≠ Q207), Y57 (= Y208), S58 (= S209), A72 (≠ T222), V73 (= V223), G79 (= G229), R80 (≠ Q230), G82 (≠ S232), S83 (≠ N233), I121 (≠ V271), T124 (= T274), E223 (= E389), F225 (= F391)
Sites not aligning to the query:
P33164 Phthalate dioxygenase reductase; PDR; EC 1.-.-.- from Burkholderia cepacia (Pseudomonas cepacia) (see paper)
28% identity, 60% coverage: 153:392/397 of query aligns to 8:227/322 of P33164
Sites not aligning to the query:
- 273 binding
- 275 binding
- 278 binding
- 281 binding
- 309 binding
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
26% identity, 54% coverage: 180:395/397 of query aligns to 40:248/250 of 1tvcA
- active site: Y63 (= Y208), S64 (= S209), L215 (≠ F362)
- binding dihydroflavine-adenine dinucleotide: F49 (≠ Y190), R61 (= R206), S62 (≠ Q207), Y63 (= Y208), S64 (= S209), L78 (≠ V223), I79 (≠ K224), R80 (= R225), L82 (= L227), F87 (≠ V231), G128 (= G272), N155 (≠ E299), E159 (≠ V303), S186 (≠ D338), G187 (≠ Y339), E242 (= E389), F244 (= F391), L245 (≠ G392)
Sites not aligning to the query:
Query Sequence
>7026032 FitnessBrowser__ANA3:7026032
MLDSRTIQVIKSTIPLLESAGPVLTQHFYERMFKHNPELKDVFNLAHQHSGGQPVALFNA
VAAYAKNIDNLGALGSAVERIAHKHTGFLIQPEQYAIVGSHLLATLKELGGKAVTEEVLT
AWADAYGFLANIFINREAQIYQESAQQDGGWSGVREFIISEKKAESLEIASFVLTPVDGK
AVKDFIPGQYLSIKAQHPKLAFDEIRQYSLSDAPNGQSYRITVKRELNGQVSNLLHDVLQ
VGDTLSVMPPAGDFTLAVQAETPVVLISAGVGQTPMKSMLNQLLKLRHPSTVTWLHACEH
GGVHGFKSAIKNKLGQHANLASHVWYREPTKADMLGQDYDFEGTMNLTSVADKIVANAHY
YFCGPIGFMASIKQQLLAFGVPSEQMHYEVFGPHAEL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory